pH dependence of the urea and guanidine hydrochloride denaturation of ribonuclease A and ribonuclease T1.


Abstract

To investigate the pH dependence of the conformational stability of ribonucleases A and T1, urea and guanidine hydrochloride denaturation curves have been determined over the pH range 2-10. The maximum conformational stability of both proteins is about 9 kcal/mol and occurs near pH 4.5 for ribonuclease T1 and between pH 7 and 9 for ribonuclease A. The pH dependence suggests that electrostatic interactions among the charged groups make a relatively small contribution to the conformational stability of these proteins. The dependence of delta G on urea concentration increases from about 1200 cal mol-1 M-1 at high pH to about 2400 cal mol-1 M-1 at low pH for ribonuclease A. This suggests that the unfolded conformations of RNase A become more accessible to urea as the net charge on the molecule increases. For RNase T1, the dependence of delta G on urea concentration is minimal near pH 6 and increases at both higher and lower pH. An analysis of information of this type for several proteins in terms of a model developed by Tanford [Tanford, C. (1964) J. Am. Chem. Soc. 86, 2050-2059] suggests that the unfolded states of proteins in urea and GdnHCl solutions may differ significantly in the extent of their interaction with denaturants. Thus, the conformations assumed by unfolded proteins may depend to at least some extent on the amino acid sequence of the protein. Study holds ProTherm entries: 2300, 2301, 2302, 2303, 2304, 2305, 2306, 2307, 2308, 2309, 2310, 2311 Extra Details: Ribonuclease A; conformational stability; electrostatic interactions

Submission Details

ID: zYwYcLvw3

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:18 p.m.

Version: 1

Publication Details
Pace CN;Laurents DV;Thomson JA,Biochemistry (1990) pH dependence of the urea and guanidine hydrochloride denaturation of ribonuclease A and ribonuclease T1. PMID:2110472
Additional Information

Study Summary

Number of data points 24
Proteins Ribonuclease pancreatic ; Ribonuclease pancreatic ; Guanyl-specific ribonuclease T1 ; Guanyl-specific ribonuclease T1
Unique complexes 2
Assays/Quantities/Protocols Experimental Assay: dG_H2O pH:9.91, buffers:glycine: 30 mM ; Experimental Assay: dG_H2O pH:2.92, buffers:formate: 30 mM ; Experimental Assay: dG_H2O pH:9.89, buffers:glycine: 30 mM ; Experimental Assay: dG_H2O buffers:MOPS: 30 mM, pH:6.98 ; Experimental Assay: dG_H2O buffers:formate: 30 mM, pH:3.02 ; Experimental Assay: Cm pH:9.91, buffers:glycine: 30 mM ; Experimental Assay: m pH:9.91, buffers:glycine: 30 mM ; Experimental Assay: dG_H2O pH:9.91, buffers:glycine: 30 mM ; Experimental Assay: Cm pH:2.92, buffers:formate: 30 mM ; Experimental Assay: m pH:2.92, buffers:formate: 30 mM ; Experimental Assay: dG_H2O pH:2.92, buffers:formate: 30 mM ; Experimental Assay: Cm pH:9.89, buffers:glycine: 30 mM ; Experimental Assay: m pH:9.89, buffers:glycine: 30 mM ; Experimental Assay: dG_H2O pH:9.89, buffers:glycine: 30 mM ; Experimental Assay: Cm buffers:MOPS: 30 mM, pH:6.98 ; Experimental Assay: m buffers:MOPS: 30 mM, pH:6.98 ; Experimental Assay: dG_H2O buffers:MOPS: 30 mM, pH:6.98 ; Experimental Assay: Cm buffers:formate: 30 mM, pH:3.02 ; Experimental Assay: m buffers:formate: 30 mM, pH:3.02 ; Experimental Assay: dG_H2O buffers:formate: 30 mM, pH:3.02
Libraries Mutations for sequence KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV ; Mutations for sequence ACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant PDB Entries

Structure ID Release Date Resolution Structure Title
1IYY 2003-10-07 NMR STRUCTURE OF Gln25-RIBONUCLEASE T1, 24 STRUCTURES
2AAS 1994-01-31 HIGH-RESOLUTION THREE-DIMENSIONAL STRUCTURE OF RIBONUCLEASE A IN SOLUTION BY NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY
1YGW 1997-10-08 NMR STRUCTURE OF RIBONUCLEASE T1, 34 STRUCTURES
6ETL 2018-02-21 0.85 Atomic resolution structure of RNase A (data collection 2)
6ETK 2018-02-21 0.85 Atomic resolution structure of RNase A (data collection 1)
1DY5 2000-03-28 0.87 Deamidated derivative of bovine pancreatic ribonuclease
6ETM 2018-02-21 0.92 Atomic resolution structure of RNase A (data collection 3)
6ETN 2018-02-21 0.92 Atomic resolution structure of RNase A (data collection 4)
6ETP 2018-02-21 1.02 Atomic resolution structure of RNase A (data collection 6)
6ETO 2018-02-21 1.02 Atomic resolution structure of RNase A (data collection 5)
1KF3 2001-12-19 1.05 Atomic Resolution Structure of RNase A at pH 5.9
2E3W 2007-10-30 1.05 X-ray structure of native RNase A
6ETQ 2018-02-21 1.08 Atomic resolution structure of RNase A (data collection 7)
2NUI 2007-10-30 1.1 X-ray Structure of synthetic [D83A]RNase A
1KF4 2001-12-19 1.1 Atomic Resolution Structure of RNase A at pH 6.3
2P45 2008-03-11 1.1 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.1A resolution: SE5B-ORTHO-1 crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
1KF2 2001-12-19 1.1 Atomic Resolution Structure of RNase A at pH 5.2
6F60 2018-04-25 1.14 The x-ray structure of bovine pancreatic ribonuclease in complex with a five-coordinate platinum(II) compound containing a sugar ligand
1KF8 2001-12-19 1.15 Atomic resolution structure of RNase A at pH 8.8
1KF7 2001-12-19 1.15 Atomic Resolution Structure of RNase A at pH 8.0
1KF5 2001-12-19 1.15 Atomic Resolution Structure of RNase A at pH 7.1
5OGH 2018-08-01 1.16 Structure of RNase A at high resolution (1.16 A) in complex with 3'-CMP and sulphate ions
6ETR 2018-02-21 1.17 Atomic resolution structure of RNase A (data collection 8)
1O0O 2003-12-09 1.2 Ribonuclease A in complex with adenosine-2',5'-diphosphate
1O0H 2003-12-09 1.2 Ribonuclease A in complex with 5'-ADP
4O36 2014-05-07 1.22 Semisynthetic RNase S1-15-H7/11-Q10
1I0V 2001-02-14 1.23 Ribonuclease T1 in complex with 2'GMP (form I crystal)
1RUV 1997-04-01 1.25 RIBONUCLEASE A-URIDINE VANADATE COMPLEX: HIGH RESOLUTION RESOLUTION X-RAY STRUCTURE (1.3 A)
7RSA 1988-10-09 1.26 STRUCTURE OF PHOSPHATE-FREE RIBONUCLEASE A REFINED AT 1.26 ANGSTROMS
3QL1 2012-02-29 1.29 Crystal Structure of Ribonuclease A Variant A4C/D83E/V118C
3I6J 2010-07-07 1.3 Ribonuclease A by Classical hanging drop method after high X-Ray dose on ESRF ID14-2 beamline
3I6F 2010-07-07 1.3 Ribonuclease A by Classical hanging drop method before high X-Ray dose on ESRF ID14-2 beamline
3I6H 2010-07-07 1.3 Ribonuclease A by LB nanotemplate method before high X-Ray dose on ESRF ID14-2 beamline
3I67 2010-07-07 1.3 Ribonuclease A by LB nanotemplate method after high X-Ray dose on ESRF ID14-2 beamline
2QCA 2007-07-03 1.33 A New Crystal Form of Bovine Pancreatic RNase A in Complex with 2'-Deoxyguanosine-5'-monophosphate
4K7L 2014-05-14 1.38 Crystal structure of RNase S variant (K7C/Q11C)
2P49 2007-08-28 1.38 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.4A resolution: native mono_1 crystal form
3DXG 2009-06-16 1.39 Ribonuclease A- uridine 5' phosphate complex
1RPG 1994-12-20 1.4 STRUCTURES OF RNASE A COMPLEXED WITH 3'-CMP AND D(CPA): ACTIVE SITE CONFORMATION AND CONSERVED WATER MOLECULES
1EID 2002-02-13 1.4 CRYSTAL STRUCTURE OF F120G MUTANT OF BOVINE PANCREATIC RIBONUCLEASE A
3DXH 2009-06-16 1.4 Ribonuclease A uridine 5' diphosphate complex
3DIB 2008-07-15 1.4 Crystal structure of bovine pancreatic ribonuclease A variant (I106A)
2BLP 2005-09-07 1.4 RNase before unattenuated X-RAY burn
4O37 2014-05-07 1.4 seminsynthetic RNase S1-15-3Pl-7/11
1EIE 2002-02-13 1.4 CRYSTAL STRUCTURE OF F120W MUTANT OF BOVINE PANCREATIC RIBONUCLEASE A
2BLZ 2005-09-07 1.4 RNAse after a high dose X-ray 'burn'
4ODK 2015-01-14 1.4 Structure of SlyD from Thermus thermophilus in complex with T1 peptide
1EIC 2002-02-13 1.4 CRYSTAL STRUCTURE OF F120A MUTANT OF BOVINE PANCREATIC RIBONUCLEASE A
1FS3 2002-02-13 1.4 CRYSTAL STRUCTURE OF WILD-TYPE BOVINE PANCREATIC RIBONUCLEASE A
1YMN 2006-01-31 1.45 The study of reductive unfolding pathways of RNase A (Y92L mutant)
4WYZ 2015-11-18 1.45 The crystal structure of the A109G mutant of RNase A in complex with 3'UMP
3RN3 1991-10-31 1.45 SEGMENTED ANISOTROPIC REFINEMENT OF BOVINE RIBONUCLEASE A BY THE APPLICATION OF THE RIGID-BODY TLS MODEL
3OQY 2010-10-20 1.49 Semi-synthetic ribonuclease S: para-cyano-phenylalanine at position 8
3QL2 2012-02-29 1.49 Crystal Structure of Ribonuclease A Variant A4C/D83E/V118C
3MZQ 2011-05-25 1.5 RNase crystals grown by the hanging drop method
1RND 1994-01-31 1.5 NEWLY OBSERVED BINDING MODE IN PANCREATIC RIBONUCLEASE
1O0N 2003-12-09 1.5 Ribonuclease A in complex with uridine-3'-phosphate
4WYP 2015-11-18 1.5 The crystal structure of the A109G mutant of RNase A in complex with 5'AMP
1O0M 2003-12-09 1.5 Ribonuclease A in complex with uridine-2'-phosphate
3MZR 2011-05-25 1.5 RNase crystals grown in loops/micromounts
1YMR 2006-01-31 1.5 The study of reductive unfolding pathways of RNase A (Y92A mutant)
1O0F 2003-12-09 1.5 RNASE A in complex with 3',5'-ADP
5RAT 1993-07-15 1.5 Effects of temperature on protein structure and dynamics: X-ray crystallographic studies of the protein ribonuclease-A at nine different temperatures from 98 TO 320 K
1RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
2RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
7RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
1RNC 1994-01-31 1.5 NEWLY OBSERVED BINDING MODE IN PANCREATIC RIBONUCLEASE
4RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
3RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
8RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
1RHB 1995-02-27 1.5 WATER DEPENDENT DOMAIN MOTION AND FLEXIBILITY IN RIBONUCLEASE A AND THE INVARIANT FEATURES IN ITS HYDRATION SHELL. AN X-RAY STUDY OF TWO LOW HUMIDITY CRYSTAL FORMS OF THE ENZYME
9RNT 1993-01-15 1.5 RIBONUCLEASE T1 WITH FREE RECOGNITION AND CATALYTIC SITE: CRYSTAL STRUCTURE ANALYSIS AT 1.5 ANGSTROMS RESOLUTION
9RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
1Z6S 2005-08-16 1.5 Ribonuclease A- AMP complex
1IZR 2003-11-25 1.5 F46A mutant of bovine pancreatic ribonuclease A
1YMW 2006-01-31 1.5 The study of reductive unfolding pathways of RNase A (Y92G mutant)
2G8Q 2006-08-15 1.5 The crystal structure of RNase A from monoclinic crystals at 100 K
1IZP 2003-11-25 1.5 F46L mutant of bovine pancreatic ribonuclease A
6RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
5D6U 2016-04-06 1.52 X-ray crystal structure of ribonuclease A determined for the real space D/H contrast method
4OKF 2015-03-04 1.54 RNase S in complex with an artificial peptide
1Z6D 2005-08-16 1.54 Ribonuclease A- IMP complex
3LXO 2010-04-28 1.55 The crystal structure of ribonuclease A in complex with thymidine-3'-monophosphate
1LOV 2002-08-21 1.55 X-ray structure of the E58A mutant of Ribonuclease T1 complexed with 3'-guanosine monophosphate
1LOY 2002-08-21 1.55 X-ray structure of the H40A/E58A mutant of Ribonuclease T1 complexed with 3'-guanosine monophosphate
3D6O 2009-02-10 1.58 The RNase A- 5'-Deoxy-5'-N-(ethyl isonipecotatyl)uridine complex
4AO1 2012-07-18 1.58 High resolution crystal structure of bovine pancreatic ribonuclease crystallized using ionic liquid
3DI8 2008-07-15 1.6 Crystal structure of bovine pancreatic ribonuclease A variant (V57A)
1W4O 2005-02-02 1.6 Binding of Nonnatural 3'-Nucleotides to Ribonuclease A
3DH6 2008-07-15 1.6 Crystal structure of bovine pancreatic ribonuclease A variant (V47A)
3DIC 2008-07-15 1.6 Crystal structure of bovine pancreatic ribonuclease A variant (V108A)
3DI7 2008-07-15 1.6 Crystal structure of bovine pancreatic ribonuclease A variant (V54A)
1ROB 1994-01-31 1.6 STRUCTURE OF THE CRYSTALLINE COMPLEX OF CYTIDYLIC ACID (2'-CMP) WITH RIBONUCLEASE AT 1.6 ANGSTROMS RESOLUTION
1RNV 1994-01-31 1.6 REFINEMENT OF THE CRYSTAL STRUCTURE OF RIBONUCLEASE S. COMPARISON WITH AND BETWEEN THE VARIOUS RIBONUCLEASE A STRUCTURES
3RSD 1998-07-15 1.6 STRUCTURE OF THE D121N VARIANT OF RIBONUCLEASE A
3FL3 2009-03-24 1.6 X-ray structure of the ligand free non covalent swapped form of the A19P/Q28L/K31C/S32C mutant of bovine pancreatic ribonuclease
1BEL 1996-10-14 1.6 HYDROLASE PHOSPHORIC DIESTER, RNA
1RNU 1994-01-31 1.6 REFINEMENT OF THE CRYSTAL STRUCTURE OF RIBONUCLEASE S. COMPARISON WITH AND BETWEEN THE VARIOUS RIBONUCLEASE A STRUCTURES
3JW1 2009-10-06 1.6 Crystal Structure of Bovine Pancreatic Ribonuclease Complexed with Uridine-5'-monophosphate at 1.60 A Resolution
3D7B 2009-02-10 1.6 The Ribonuclease A- 5'-Deoxy-5'-N-pyrrolidinouridine complex
2RNS 1994-01-31 1.6 REFINEMENT OF THE CRYSTAL STRUCTURE OF RIBONUCLEASE S. COMPARISON WITH AND BETWEEN THE VARIOUS RIBONUCLEASE A STRUCTURES
3D6P 2009-02-10 1.6 RNase A- 5'-Deoxy-5'-N-morpholinouridine complex
1A5P 1998-05-27 1.6 C[40,95]A VARIANT OF BOVINE PANCREATIC RIBONUCLEASE A
2OP2 2007-10-30 1.6 Crystal structure of RNase double-mutant V43C R85C with extra disulphide bond
3DH5 2008-07-15 1.6 Crystal structure of bovine pancreatic ribonuclease A (wild-type)
3D6Q 2009-02-10 1.6 The RNase A- 5'-Deoxy-5'-N-piperidinouridine complex
4RSD 1998-07-15 1.6 STRUCTURE OF THE D121A VARIANT OF RIBONUCLEASE A
1I0X 2001-02-14 1.65 RIBONUCLEASE T1 IN COMPLEX WITH 2'GMP (FORM II CRYSTAL)
4L55 2014-01-29 1.65 X-ray structure of the adduct between bovine pancreatic ribonuclease and AziRu
4GSP 1998-08-12 1.65 RIBONUCLEASE T1 COMPLEXED WITH 2',3'-CGPS + 3'-GMP, 7 DAYS
3EUX 2009-06-23 1.65 Crystal Structure of Crosslinked Ribonuclease A
2P43 2008-03-11 1.65 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.65A resolution: SE3-mono-1 crystal form with three se-met sites (M34, M51, M83) in vhh scaffold
1W4Q 2005-02-02 1.68 Binding of Nonnatural 3'-Nucleotides to Ribonuclease A
3EV3 2009-06-23 1.68 Crystal Structure of Ribonuclease A in 70% t-Butanol
3MWQ 2011-02-09 1.68 Crystal structure of ribonuclease A tandem enzymes and their interaction with the cytosolic ribonuclease inhibitor
3EV5 2009-06-23 1.68 Crystal Structure of Ribonuclease A in 1M Trimethylamine N-Oxide
5E5F 2015-12-09 1.68 X-ray structure of the complex between RNase A and compound 4-PF6 ([(PPh3)Au(mi-pbi)Pt(Me)(DMSO)][PF6]), the heterobimetallic derivative obtained in the reaction between the organometallic compound [Pt(pbi)(Me)(DMSO)], pbi=2-(2'-pyridil)benzimidazole (compound 3) and the gold(I) compound [Au(Ph3P)][PF6]
1W4P 2005-02-02 1.69 Binding of Nonnatural 3'-Nucleotides to Ribonuclease A
1RBX 1995-10-15 1.69 RIBONUCLEASE A (E.C.3.1.27.5) CONTROL
1RBW 1995-10-15 1.69 RIBONUCLEASE A (E.C.3.1.27.5) WITH GUANIDINIUM
4J61 2014-01-22 1.69 Crystal structure of Ribonuclease A soaked in 40% Cyclopentanone: One of twelve in MSCS set
4J60 2014-01-22 1.69 Crystal structure of Ribonuclease A soaked in 25% Cyclopentanol: One of twelve in MSCS set
1RGA 1993-10-31 1.7 CRYSTAL STRUCTURE OF RNASE T1 WITH 3'-GMP AND GUANOSINE: A PRODUCT COMPLEX
1Q9E 2004-03-23 1.7 RNase T1 variant with adenine specificity
2W5G 2009-02-17 1.7 RNASE A-5'-ATP COMPLEX
4G8V 2012-11-21 1.7 Crystal structure of Ribonuclease A in complex with 5a
1RAS 1993-10-31 1.7 CRYSTAL STRUCTURE OF A FLUORESCENT DERIVATIVE OF RNASE A
1F0V 2001-02-21 1.7 Crystal structure of an Rnase A dimer displaying a new type of 3D domain swapping
3RSP 1998-04-22 1.7 STRUCTURE OF THE P93G VARIANT OF RIBONUCLEASE A
2W5L 2009-02-17 1.7 RNASE A-NADP COMPLEX
2W5K 2009-02-17 1.7 RNASE A-NADPH COMPLEX
1AFK 1998-03-18 1.7 CRYSTAL STRUCTURE OF RIBONUCLEASE A IN COMPLEX WITH 5'-DIPHOSPHOADENOSINE-3'-PHOSPHATE
1HYF 2001-02-14 1.7 RIBONUCLEASE T1 V16A MUTANT IN COMPLEX WITH SR2+
1AFL 1998-03-18 1.7 RIBONUCLEASE A IN COMPLEX WITH 5'-DIPHOSPHOADENOSINE 2'-PHOSPHATE AT 1.7 ANGSTROM RESOLUTION
1QHC 1999-08-31 1.7 CRYSTAL STRUCTURE OF RIBONUCLEASE A IN COMPLEX WITH 5'-PHOSPHO-2'-DEOXYURIDINE-3'-PYROPHOSPHATE ADENOSINE-3'-PHOSPHATE
3A1R 2009-09-01 1.7 Neutron crystal structure analysis of bovine pancreatic ribonuclease A
1RBH 1993-10-31 1.7 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
4BIR 1998-07-15 1.7 RIBONUCLEASE T1: FREE HIS92GLN MUTANT
2G8R 2006-08-15 1.7 The crystal structure of the RNase A- 3-N-piperidine-4-carboxyl-3-deoxy-ara-uridine complex
1C9V 2001-06-27 1.7 H12A VARIANT OF RIBONUCLEASE A
1RBD 1993-10-31 1.7 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
2XOG 2011-01-19 1.72 Functional and Structural Analyses of N-Acylsulfonamide-Linked Dinucleoside Inhibitors of Ribonuclease A
2XOI 2011-01-19 1.72 Functional and Structural Analyses of N-Acylsulfonamide-Linked Dinucleoside Inhibitors of Ribonuclease A
3D8Y 2009-02-10 1.72 RNase A- 5'-Deoxy-5'-N-piperidinothymidine complex
3QSK 2011-08-10 1.75 5 Histidine Variant of the anti-RNase A VHH in Complex with RNAse A
1RBE 1993-10-31 1.75 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
4POU 2014-09-24 1.75 VHH-metal in Complex with RNase A
3EV6 2009-06-23 1.76 Crystal Structure of Ribonuclease A in 50% R,S,R-Bisfuranol
1I3I 2001-03-07 1.76 Ribonuclease T1 V78T mutant
3EV0 2009-06-23 1.76 Crystal Structure of Ribonuclease A in 70% Dimethyl Sulfoxide
3BU4 1998-09-23 1.77 RIBONUCLEASE T1 COMPLEX WITH 2'GMP
5BU4 1998-09-23 1.77 RIBONUCLEASE T1 COMPLEX WITH 2'GMP
5OLD 2018-08-29 1.78 X-ray structure of the adduct formed upon reaction of ribonuclease A with a tetranuclear Pt-thiosemicarbazone compound
4J68 2014-01-22 1.78 Crystal structure of Ribonuclease A soaked in 40% Isopropanol: One of twelve in MSCS set
4J64 2014-01-22 1.78 Crystal structure of Ribonuclease A soaked in 40% Dioxane: One of twelve in MSCS set
1JVU 2002-06-05 1.78 CRYSTAL STRUCTURE OF RIBONUCLEASE A (COMPLEXED FORM)
5JLG 2016-08-03 1.79 The X-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and compound I, a piano-stool organometallic Ru(II) arene compound containing an O,S-chelating ligand
2GSP 1998-08-12 1.8 RIBONUCLEASE T1/2',3'-CGPS AND 3'-GMP, 2 DAYS
1XPS 1998-05-27 1.8 BOVINE RIBONUCLEASE A (PHOSPHATE-FREE) (93 % HUMIDITY)
1I2E 2001-03-07 1.8 Ribonuclease T1 V16A mutant, form I
2AAE 1994-01-31 1.8 THE ROLE OF HISTIDINE-40 IN RIBONUCLEASE T1 CATALYSIS: THREE-DIMENSIONAL STRUCTURES OF THE PARTIALLY ACTIVE HIS40LYS MUTANT
1RNN 1996-04-03 1.8 RIBONUCLEASE A COMPLEX WITH CYTIDYLIC ACID (5'CMP) CRYSTALLIZED FROM 8M SODIUM FORMATE
8RNT 1993-01-15 1.8 STRUCTURE OF RIBONUCLEASE T1 COMPLEXED WITH ZINC(II) AT 1.8 ANGSTROMS RESOLUTION: A ZN2+.6H2O.CARBOXYLATE CLATHRATE
3RNT 1989-10-15 1.8 CRYSTAL STRUCTURE OF GUANOSINE-FREE RIBONUCLEASE T1, COMPLEXED WITH VANADATE(V), SUGGESTS CONFORMATIONAL CHANGE UPON SUBSTRATE BINDING
2W5M 2009-02-17 1.8 RNASE A-PYROPHOSPHATE ION COMPLEX
2RNT 1989-10-15 1.8 THREE-DIMENSIONAL STRUCTURE OF RIBONUCLEASE T1 COMPLEXED WITH GUANYLYL-2(PRIME),5(PRIME)-GUANOSINE AT 1.8 ANGSTROMS RESOLUTION
1JN4 2003-06-03 1.8 The Crystal Structure of Ribonuclease A in complex with 2'-deoxyuridine 3'-pyrophosphate (P'-5') adenosine
1FZU 2000-10-25 1.8 RNAse T1 V78A mutant
5GSP 1998-03-18 1.8 RIBONUCLEASE T1/3'-GMP, 9 WEEKS
1RHA 1995-02-27 1.8 WATER DEPENDENT DOMAIN MOTION AND FLEXIBILITY IN RIBONUCLEASE A AND THE INVARIANT FEATURES IN ITS HYDRATION SHELL. AN X-RAY STUDY OF TWO LOW HUMIDITY CRYSTAL FORMS OF THE ENZYME
4G8Y 2012-11-21 1.8 Crystal structure of Ribonuclease A in complex with 5b
9RSA 1991-04-15 1.8 CRYSTAL STRUCTURE OF TWO COVALENT NUCLEOSIDE DERIVATIVES OF RIBONUCLEASE A
4ZZ4 2016-04-06 1.8 Neutron crystal structure of ribonuclease A determined by the real space D/H contrast method
2P42 2008-03-11 1.8 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.8A resolution: SE3-mono-2 crystal form with three se-met sites (M34, M51, M83) in vhh scaffold
4K7M 2013-11-27 1.8 Crystal structure of RNase S variant (K7C/Q11C) with bound mercury ions
6RNT 1993-01-15 1.8 CRYSTAL STRUCTURE OF RIBONUCLEASE T1 COMPLEXED WITH ADENOSINE 2'-MONOPHOSPHATE AT 1.8-ANGSTROMS RESOLUTION
1RBI 1993-10-31 1.8 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
2APQ 2005-09-13 1.8 Crystal Structure of an Active Site Mutant of Bovine Pancreatic Ribonuclease A (H119A-RNase A) with a 10-Glutamine expansion in the C-terminal hinge-loop.
5D97 2016-04-06 1.8 Neutron crystal structure of H2O-solvent ribonuclease A
1RNW 1997-04-01 1.8 RECOMBINANT RIBONUCLEASE A CRYSTALLIZED FROM 80% AMMONIUM SULPHATE
4J5Z 2014-01-22 1.8 Crystal structure of Ribonuclease A in aqueous solution: One of twelve in MSCS set
1Z3L 2005-03-29 1.8 X-Ray Crystal Structure of a Mutant Ribonuclease S (F8Anb)
1RBG 1993-10-31 1.8 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
1HZ1 2001-01-31 1.8 RIBONUCLEASE T1 V16A MUTANT IN COMPLEX WITH MG2+
4BU4 1998-09-23 1.8 RIBONUCLEASE T1 COMPLEX WITH 2'GMP
4WYN 2015-11-18 1.8 The crystal structure of the A109G mutant of RNase A
1RBF 1993-10-31 1.8 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
1C9X 2001-06-27 1.8 H119A VARIANT OF RIBONUCLEASE A
1BIR 1996-08-17 1.8 RIBONUCLEASE T1, PHE 100 TO ALA MUTANT COMPLEXED WITH 2' GMP
1IZQ 2003-11-25 1.8 F46V mutant of bovine pancreatic ribonuclease A
1DET 1996-07-11 1.8 RIBONUCLEASE T1 CARBOXYMETHYLATED AT GLU 58 IN COMPLEX WITH 2'GMP
1C8W 2002-05-01 1.8 THR45GLY VARIANT OF RIBONUCLEASE A
8RSA 1991-04-15 1.8 CRYSTAL STRUCTURE OF TWO COVALENT NUCLEOSIDE DERIVATIVES OF RIBONUCLEASE A
1RN4 1993-01-15 1.8 HIS92ALA MUTATION IN RIBONUCLEASE T1 INDUCES SEGMENTAL FLEXIBILITY. AN X-RAY STUDY
1SRN 1990-10-15 1.8 THE REFINED CRYSTAL STRUCTURE OF A FULLY ACTIVE SEMISYNTHETIC RIBONUCLEASE AT 1.8 ANGSTROMS RESOLUTION
2P44 2008-03-11 1.8 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.8A resolution: SE5A-mono-1 crystal form with five se-met sites (M34, M51, F68M, M83, L86M) in vhh scaffold
3BIR 1997-12-31 1.8 DISECTING HISTIDINE INTERACTIONS IN RIBONUCLEASE T1 BY ASN AND GLN SUBSTITUTIONS
5OBE 2017-07-26 1.82 X-ray structure of the adduct formed upon reaction of ribonuclease A with the compound fac-[RuII(CO)3Cl2(N3-MBI), MBI=methyl-benzimidazole
2G4W 2007-02-20 1.84 anomalous substructure of ribonuclease A (C2)
3EUZ 2009-06-23 1.84 Crystal Structure of Ribonuclease A in 50% Dimethylformamide
1RN1 1994-01-31 1.84 THREE-DIMENSIONAL STRUCTURE OF GLN 25-RIBONUCLEASE T1 AT 1.84 ANGSTROMS RESOLUTION: STRUCTURAL VARIATIONS AT THE BASE RECOGNITION AND CATALYTIC SITES
2RLN 1994-11-01 1.85 THERMODYNAMIC AND STRUCTURAL CONSEQUENCES OF CHANGING A SULPHUR ATOM TO A METHYLENE GROUP IN THE M13NLE MUTATION IN RIBONUCLEASE S
3MWR 2011-02-09 1.85 Crystal structure of ribonuclease A tandem enzymes and their interaction with the cytosolic ribonuclease inhibitor
5JMG 2016-07-27 1.85 X-ray structure of the complex between bovine pancreatic ribonuclease and pentachlorocarbonyliridate(III) (4 days of soaking)
1I2G 2001-03-07 1.85 Ribonuclease T1 V16T mutant
4OT4 2014-07-09 1.85 X-ray Structure of the Adduct formed between cisplatin and Ribonuclease A
1G02 2000-10-25 1.86 Ribonuclease T1 V16S mutant
4J67 2014-01-22 1.86 Crystal structure of Ribonuclease A soaked in 50% 1,6-Hexanediol: One of twelve in MSCS set
1RGK 1993-01-15 1.87 RNASE T1 MUTANT GLU46GLN BINDS THE INHIBITORS 2'GMP AND 2'AMP AT THE 3' SUBSITE
4J69 2014-01-22 1.89 Crystal structure of Ribonuclease A soaked in 50% S,R,S-bisfuranol: One of twelve in MSCS set
4OOH 2015-02-25 1.89 Structure of RIBONUCLEASE A at 40C
1RAR 1993-10-31 1.9 CRYSTAL STRUCTURE OF A FLUORESCENT DERIVATIVE OF RNASE A
1RCA 1995-09-15 1.9 STRUCTURE OF THE CRYSTALLINE COMPLEX OF DEOXYCYTIDYLYL-3',5'-GUANOSINE (3',5'-DCPDG) CO-CRYSTALISED WITH RIBONUCLEASE AT 1.9 ANGSTROMS RESOLUTION. RETROBINDING IN PANCREATIC RNASEA IS INDEPENDENT OF MODE OF INHIBITOR INTROMISSION
1C0B 1999-10-14 1.9 BOVINE PANCREATIC RIBONUCLEASE A DESICCATED FOR 2.5 DAYS
1BU4 1999-02-16 1.9 RIBONUCLEASE 1 COMPLEX WITH 2'GMP
1LRA 1994-01-31 1.9 CRYSTALLOGRAPHIC STUDY OF GLU 58 ALA RNASE T1(ASTERISK)2'-GUANOSINE MONOPHOSPHATE AT 1.9 ANGSTROMS RESOLUTION
7RNT 1993-01-15 1.9 CRYSTAL STRUCTURE OF THE TYR45TRP MUTANT OF RIBONUCLEASE T1 IN A COMPLEX WITH 2'-ADENYLIC ACID
1RNT 1987-10-16 1.9 RESTRAINED LEAST-SQUARES REFINEMENT OF THE CRYSTAL STRUCTURE OF THE RIBONUCLEASE T1(ASTERISK)2(PRIME)-GUANYLIC ACID COMPLEX AT 1.9 ANGSTROMS RESOLUTION
1BVI 1998-09-23 1.9 RIBONUCLEASE T1 (WILDTYPE) COMPLEXED WITH 2'GMP
3GSP 1998-08-12 1.9 RIBONUCLEASE T1 COMPLEXED WITH 2',3'-CGPS + 3'-GMP, 4 DAYS
1RLS 1994-12-20 1.9 CRYSTAL STRUCTURE OF RNASE T1 COMPLEXED WITH THE PRODUCT NUCLEOTIDE 3'-GMP. STRUCTURAL EVIDENCE FOR DIRECT INTERACTION OF HISTIDINE 40 AND GLUTAMIC ACID 58 WITH THE 2'-HYDROXYL GROUP OF RIBOSE
2P4A 2007-08-28 1.9 X-ray structure of a camelid affinity matured single-domain vhh antibody fragment in complex with RNASE A
3FL1 2009-03-24 1.9 X-ray structure of the non covalent swapped form of the A19P/Q28L/K31C/S32C mutant of bovine pancreatic ribonuclease in complex with 2'-DEOXYCYTIDINE-2'-DEOXYGUANOSINE-3',5'-MONOPHOSPHATE
1LOW 2002-08-21 1.9 X-ray structure of the H40A mutant of Ribonuclease T1 complexed with 3'-guanosine monophosphate
1WBU 2005-01-27 1.9 Fragment based lead discovery using crystallography
1RNZ 1997-04-01 1.9 RIBONUCLEASE A CRYSTALLIZED FROM 2.5M SODIUM CHLORIDE, 3.3M SODIUM FORMATE
1RNO 1996-04-03 1.9 RIBONUCLEASE A CRYSTALLIZED FROM 80% AMMONIUM SULPHATE
2HOH 1998-09-23 1.9 RIBONUCLEASE T1 (N9A MUTANT) COMPLEXED WITH 2'GMP
4G90 2012-11-21 1.9 Crystal structure of Ribonuclease A in complex with 5e
1RNX 1996-11-08 1.9 RIBONUCLEASE A CRYSTALLIZED FROM 3M SODIUM CHLORIDE, 30% AMMONIUM SULFATE
1XPT 1998-05-27 1.9 BOVINE RIBONUCLEASE A (PHOSPHATE-FREE)
1LSQ 1997-01-11 1.9 RIBONUCLEASE A WITH ASN 67 REPLACED BY A BETA-ASPARTYL RESIDUE
3EV4 2009-06-23 1.93 Crystal Structure of Ribonuclease A in 50% Trifluoroethanol
3FL0 2009-03-24 1.94 X-ray structure of the non covalent swapped form of the Q28L/K31C/S32C mutant of bovine pancreatic ribonuclease in complex with 2'-DEOXYCYTIDINE-2'-DEOXYGUANOSINE-3',5'-MONOPHOSPHATE
1RHL 1998-10-14 1.95 RIBONUCLEASE T1 COMPLEXED WITH 2'GMP/G23A MUTANT
1I2F 2001-03-07 1.95 Ribonuclease T1 V16A mutant, form II
3EUY 2009-06-23 1.95 Crystal Structure of Ribonuclease A in 50% Dioxane
2G4X 2007-02-20 1.95 Anomalous substructure od ribonuclease A (P3221)
4RTE 2015-03-25 1.95 The X-ray structure of bovine pancreatic ribonuclease incubated in the presence of an excess of cisplatin (1:10 ratio)
3SYU 2012-03-28 1.95 Re-refined coordinates for pdb entry 1det - ribonuclease T1 carboxymethylated at GLU 58 in complex with 2'GMP
2BU4 1998-09-23 1.95 RIBONUCLEASE T1 COMPLEX WITH 2'GMP
3HOH 1998-09-16 1.95 RIBONUCLEASE T1 (THR93GLN MUTANT) COMPLEXED WITH 2'GMP
4J65 2014-01-22 1.96 Crystal structure of Ribonuclease A soaked in 40% Dimethylformamide: One of twelve in MSCS set
5OBD 2017-07-26 1.98 X-ray structure of the adduct formed upon reaction of ribonuclease A with the compound fac-[RuII(CO)3Cl2(N3-MIM), MIM=methyl-imidazole
3D8Z 2009-02-10 1.98 RNase A- 5'-Deoxy-5'-N-pyrrolidinothymidine complex
5E5E 2015-12-09 1.98 X-ray structure of the adduct formed in the reaction between RNase A and a neutral organometallic derivative [Pt(pbi)(Me)(DMSO)], pbi=2-(2'-pyridil)benzimidazole (compound 3)
3FKZ 2009-03-24 1.99 X-ray structure of the non covalent swapped form of the S16G/T17N/A19P/A20S/K31C/S32C mutant of bovine pancreatic ribonuclease
1SSB 1994-09-30 2.0 A STRUCTURAL INVESTIGATION OF CATALYTICALLY MODIFIED F12OL AND F12OY SEMISYNTHETIC RIBONUCLEASES
1SSC 1995-01-26 2.0 THE 1.6 ANGSTROMS STRUCTURE OF A SEMISYNTHETIC RIBONUCLEASE CRYSTALLIZED FROM AQUEOUS ETHANOL. COMPARISON WITH CRYSTALS FROM SALT SOLUTIONS AND WITH RNASE A FROM AQUEOUS ALCOHOL SOLUTIONS
1B6V 1999-06-15 2.0 CRYSTAL STRUCTURE OF A HYBRID BETWEEN RIBONUCLEASE A AND BOVINE SEMINAL RIBONUCLEASE
2AAD 1994-01-31 2.0 THE ROLE OF HISTIDINE-40 IN RIBONUCLEASE T1 CATALYSIS: THREE-DIMENSIONAL STRUCTURES OF THE PARTIALLY ACTIVE HIS40LYS MUTANT
1RGC 1994-01-31 2.0 THE COMPLEX BETWEEN RIBONUCLEASE T1 AND 3'-GUANYLIC ACID SUGGESTS GEOMETRY OF ENZYMATIC REACTION PATH. AN X-RAY STUDY
1EOW 2000-11-17 2.0 CRYSTAL STRUCTURE OF RIBONUCLEASE A COMPLEXED WITH URIDYLYL(2',5')GUANOSINE (NON-PRODUCTIVE BINDING)
1U1B 2005-06-28 2.0 Structure of bovine pancreatic Ribonuclease A in complex with 3'-phosphothymidine (3'-5')-pyrophosphate adenosine 3'-phosphate
5BIR 1997-12-31 2.0 DISECTING HISTIDINE INTERACTIONS IN RIBONUCLEASE T1 USING ASN AND GLN MUTATIONS
4QH3 2014-07-30 2.0 X-ray structure of the adduct formed between bovine pancreatic ribonuclease and trans-dimethylamine methylamine dichlorido platinum(II)
1KH8 2003-06-17 2.0 Structure of a cis-proline (P114) to glycine variant of Ribonuclease A
1B2M 1999-03-25 2.0 THREE-DIMENSIONAL STRUCTURE OF RIBONULCEASE T1 COMPLEXED WITH AN ISOSTERIC PHOSPHONATE ANALOGUE OF GPU: ALTERNATE SUBSTRATE BINDING MODES AND CATALYSIS.
1Z3P 2005-03-29 2.0 X-Ray crystal structure of a mutant Ribonuclease S (M13Nva)
1RGL 1993-01-15 2.0 RNASE T1 MUTANT GLU46GLN BINDS THE INHIBITORS 2'GMP AND 2'AMP AT THE 3' SUBSITE
1AQP 1998-05-27 2.0 RIBONUCLEASE A COPPER COMPLEX
1C0C 1999-10-14 2.0 BOVINE PANCREATIC RIBONUCLEASE A DESICCATED FOR 4.0 DAYS
3SRN 1994-12-20 2.0 STRUCTURAL CHANGES THAT ACCOMPANY THE REDUCED CATALYTIC EFFICIENCY OF TWO SEMISYNTHETIC RIBONUCLEASE ANALOGS
1RNY 1996-11-08 2.0 RIBONUCLEASE A CRYSTALLIZED FROM 3M CESIUM CHLORIDE, 30% AMMONIUM SULFATE
1Z3M 2005-03-29 2.0 Crystal structure of mutant Ribonuclease S (F8Nva)
1EOS 2000-08-30 2.0 CRYSTAL STRUCTURE OF RIBONUCLEASE A COMPLEXED WITH URIDYLYL(2',5')GUANOSINE (PRODUCTIVE BINDING)
5RSA 1985-07-17 2.0 COMPARISON OF TWO INDEPENDENTLY REFINED MODELS OF RIBONUCLEASE-A
3EV1 2009-06-23 2.0 Crystal Structure of Ribonuclease A in 70% Hexanediol
6RSA 1986-05-07 2.0 NUCLEAR MAGNETIC RESONANCE AND NEUTRON DIFFRACTION STUDIES OF THE COMPLEX OF RIBONUCLEASE*A WITH URIDINE VANADATE, A TRANSITION-STATE ANALOGUE
1FYS 2000-10-25 2.0 Ribonuclease T1 V16C mutant
1RNM 1996-04-03 2.0 RIBONUCLEASE A COMPLEX WITH CYTIDYLIC ACID (5'CMP) CRYSTALLIZED FROM 80% AMMONIUM SULPHATE
3RSK 1998-07-15 2.0 STRUCTURE OF THE K7A/R10A/K66A VARIANT OF RIBONUCLEASE A
7GSP 1998-03-18 2.0 RIBONUCLEASE T1/2',3'-CGPS, NON-PRODUCTIVE
1SSA 1994-09-30 2.0 A STRUCTURAL INVESTIGATION OF CATALYTICALLY MODIFIED F12OL AND F12OY SEMISYNTHETIC RIBONUCLEASES
1RNQ 1996-04-03 2.0 RIBONUCLEASE A CRYSTALLIZED FROM 8M SODIUM FORMATE
4SRN 1994-12-20 2.0 STRUCTURAL CHANGES THAT ACCOMPANY THE REDUCED CATALYTIC EFFICIENCY OF TWO SEMISYNTHETIC RIBONUCLEASE ANALOGS
1AFU 1998-03-18 2.0 STRUCTURE OF RIBONUCLEASE A AT 2.0 ANGSTROMS FROM MONOCLINIC CRYSTALS
1RSM 1986-01-21 2.0 THE 2-ANGSTROMS RESOLUTION STRUCTURE OF A THERMOSTABLE RIBONUCLEASE A CHEMICALLY CROSS-LINKED BETWEEN LYSINE RESIDUES 7 AND 41
5HOH 1998-09-23 2.0 RIBONUCLEASE T1 (ASN9ALA/THR93ALA DOUBLEMUTANT) COMPLEXED WITH 2'GMP
1RBC 1993-10-31 2.0 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
3DI9 2008-07-15 2.0 Crystal structure of bovine pancreatic ribonuclease A variant (I81A)
3EV2 2009-06-23 2.02 Crystal Structure of Ribonuclease A in 70% Isopropanol
6QE9 2019-02-27 2.03 The X-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and complex I, a pentacoordinate Pt(II) compound containing 2,9-dimethyl-1,10-phenanthroline, dimethylfumarate, methyl and iodine as ligands
4J62 2014-01-22 2.04 Crystal structure of Ribonuclease A soaked in 40% Cyclohexanol: One of twelve in MSCS set
4J66 2014-01-22 2.04 Crystal structure of Ribonuclease A soaked in 25% Dimethyl sulfoxide: One of twelve in MSCS set
4J63 2014-01-22 2.04 Crystal structure of Ribonuclease A soaked in 40% Cyclohexanone: One of twelve in MSCS set
4J6A 2014-01-22 2.04 Crystal structure of Ribonuclease A soaked in 40% 2,2,2-Trifluoroethanol: One of twelve in MSCS set
1JVT 2002-06-05 2.05 CRYSTAL STRUCTURE OF RIBONUCLEASE A (LIGAND-FREE FORM)
4HOH 1998-09-23 2.05 RIBONUCLEASE T1 (THR93ALA MUTANT) COMPLEXED WITH 2'GMP
5NA9 2017-08-16 2.07 The X-ray structure of bovine pancreatic ribonuclease incubated in the presence of an excess of carboplatin (1:10 ratio)
5OBC 2017-07-26 2.07 X-ray structure of the adduct formed upon reaction of ribonuclease A with the compound fac-[RuII(CO)3Cl2(N3-IM), IM=imidazole
4S0Q 2015-11-18 2.09 The X-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and carboplatin
4RSK 1998-12-09 2.1 STRUCTURE OF THE K7A/R10A/K66A VARIANT OF RIBONUCLEASE A COMPLEXED WITH 3'-UMP
5ET4 2016-11-30 2.1 Structure of RNase A-K7H/R10H in complex with 3'-CMP
1J80 2001-06-06 2.1 Osmolyte Stabilization of RNase
1TTO 2005-09-06 2.1 Crystal structure of the Rnase T1 variant R2
1A2W 1998-04-29 2.1 CRYSTAL STRUCTURE OF A 3D DOMAIN-SWAPPED DIMER OF BOVINE PANCREATIC RIBONUCLEASE A
1RBN 1994-12-20 2.1 THE STRUCTURE OF RIBONUCLEASE A DERIVATIVE II AT 2.1 ANGSTROMS RESOLUTION
3MX8 2011-02-09 2.1 Crystal structure of ribonuclease A tandem enzymes and their interaction with the cytosolic ribonuclease inhibitor
1GV7 2002-08-22 2.1 ARH-I, an angiogenin/RNase A chimera
3RH1 2012-02-15 2.1 X-ray Structure of a cis-proline (P114) to alanine variant of Ribonuclease A
5NJ7 2018-05-16 2.15 The X-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and arsenoplatin-1
3RID 2012-02-15 2.18 X-ray structure of the C-terminal swapped dimer of P114A variant of Ribonuclease A
4YGW 2015-07-01 2.18 RNase S in complex with stabilized S peptide
1RPH 1994-12-20 2.2 STRUCTURES OF RNASE A COMPLEXED WITH 3'-CMP AND D(CPA): ACTIVE SITE CONFORMATION AND CONSERVED WATER MOLECULES
1JS0 2002-03-13 2.2 Crystal Structure of 3D Domain-swapped RNase A Minor Trimer
6GSP 1998-03-18 2.2 RIBONUCLEASE T1/3'-GMP, 15 WEEKS
1GSP 1998-02-25 2.2 RIBONUCLEASE T1 COMPLEXED WITH 2',3'-CGPS, 1 DAY
1J81 2001-06-06 2.2 Osmolyte Stabilization of RNase
1RPF 1994-12-20 2.2 THE STRUCTURES OF RNASE COMPLEXED WITH 3'-CMP AND D(CPA): ACTIVE SITE CONFORMATION AND CONSERVED WATER MOLECULES
1JVV 2002-06-05 2.2 CRYSTAL STRUCTURE OF RIBONUCLEASE A (RETRO-SOAKED FORM)
4RNT 1992-01-15 2.2 HIS 92 ALA MUTATION IN RIBONUCLEASE T1 INDUCES SEGMENTAL FLEXIBILITY. AN X-RAY STUDY
4PEQ 2014-06-25 2.21 Structure of bovine ribonuclease inhibitor complexed with bovine ribonuclease I
1D5E 1999-10-20 2.25 The role of phenylalanine 8 in the stabilization of the S protein-S peptide interaction: Packing and cavities
1J7Z 2001-06-06 2.25 Osmolyte Stabilization of Ribonuclease
4MXF 2013-12-25 2.25 X-ray structure of the adduct between bovine pancreatic ribonuclease and Auoxo6, a dinuclear gold(III) complex with -dioxo bridges linking the two metal centers
1D5D 1999-10-20 2.25 The role of phenylalanine 8 in the stabilization of the s protein-s peptide interaction: packing and cavities
1D5H 1999-10-20 2.25 Rnase s(f8a). mutant ribonucleasE S.
1FEV 2000-08-09 2.25 CRYSTAL STRUCTURE OF THE ALA4AIB MUTATION IN RNASE S
4S18 2015-11-25 2.27 The X-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and oxaliplatin
5JML 2016-07-27 2.29 X-ray structure of the complex between bovine pancreatic ribonuclease and penthachlorocarbonyliridate(III) (2 months of soaking)
2OQF 2008-02-12 2.3 Structure of a synthetic, non-natural analogue of RNase A: [N71K(Ade), D83A]RNase A
1TRQ 1994-04-30 2.3 X-RAY CRYSTALLOGRAPHIC AND CALORIMERIC STUDIES OF THE EFFECTS OF THE MUTATION TRP 59 TYR IN RIBONUCLEASE T1
3OR0 2010-10-20 2.3 Semi-synthetic ribonuclease S: cyanylated homocysteine at position 13
1A5Q 1998-05-27 2.3 P93A VARIANT OF BOVINE PANCREATIC RIBONUCLEASE A
2BIR 1997-06-16 2.3 ADDITIVITY OF SUBSTRATE BINDING IN RIBONUCLEASE T1 (Y42A MUTANT)
1CJR 1999-05-07 2.3 X-RAY CRYSTALLOGRAPHIC STUDIES OF DENATURATION IN RIBONUCLEASE S
2P48 2008-03-11 2.3 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 2.3A resolution: SE5B-tetra crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
1J82 2001-06-06 2.3 Osmolyte Stabilization of RNase
1CH0 1999-12-22 2.3 RNASE T1 VARIANT WITH ALTERED GUANINE BINDING SEGMENT
6QMN 2019-05-08 2.31 Crystal structure of a Ribonuclease A-Onconase chimera
1RCN 1994-09-30 2.32 CRYSTAL STRUCTURE OF THE RIBONUCLEASE A D(APTPAPAPG) COMPLEX : DIRECT EVIDENCE FOR EXTENDED SUBSTRATE RECOGNITION
3I7W 2009-08-04 2.35 High pressure structure of wild-type RNase A (0.67 GPa)
1I3F 2001-03-07 2.35 Ribonuclease T1 V89S mutant
1TRP 1994-04-30 2.4 X-RAY CRYSTALLOGRAPHIC AND CALORIMERIC STUDIES OF THE EFFECTS OF THE MUTATION TRP 59 TYR IN RIBONUCLEASE T1
3I7Y 2009-08-04 2.4 High pressure structure of I106A variant of RNase A (0.48 GPa)
2W5I 2009-02-17 2.4 RNASE A-AP3A COMPLEX
1RBB 1988-07-16 2.5 THE CRYSTAL STRUCTURE OF RIBONUCLEASE B AT 2.5-ANGSTROMS RESOLUTION
2P46 2008-03-11 2.5 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 2.5A resolution: se5b-ortho-2 crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
2P47 2008-03-11 2.5 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 2.5A resolution: SE5B-TRI crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
1DFJ 1997-01-11 2.5 RIBONUCLEASE INHIBITOR COMPLEXED WITH RIBONUCLEASE A
3OQZ 2010-10-20 2.5 Semi-synthetic ribonuclease S: meta-cyano-phenylalanine at position 8
1RTA 1993-10-31 2.5 CRYSTAL STRUCTURE DISPOSITION OF THYMIDYLIC ACID TETRAMER IN COMPLEX WITH RIBONUCLEASE A
1RTB 1993-10-31 2.5 CRYSTAL STRUCTURE DISPOSITION OF THYMIDYLIC ACID TETRAMER IN COMPLEX WITH RIBONUCLEASE A
1UN5 2004-02-06 2.6 ARH-II, AN ANGIOGENIN/RNASE A CHIMERA
3I7X 2009-08-04 2.6 High pressure structure of I106A RNase A variant (0.35 GPa)
6GOK 2018-07-25 2.65 X-ray structure of the adduct formed upon reaction of bovine pancreatic ribonuclease with a Pd(II) complex bearing N,N-pyridylbenzimidazole derivative with an alkylated sulphonate side chain
2E33 2007-03-20 2.7 Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
1RBJ 1995-12-07 2.7 RIBONUCLEASE B COMPLEX WITH D(TETRA-(DEOXY-ADENYLATE))
1BZQ 1998-11-11 2.8 COMPLEX OF A DROMEDARY SINGLE-DOMAIN VHH ANTIBODY FRAGMENT WITH RNASE A
1CJQ 1999-05-07 3.0 X-RAY CRYSTALLOGRAPHIC STUDIES OF THE DENATURATION OF THE DENATURATION OF RIBONUCLEASE S.
3URP 2012-03-28 3.19 Re-refinement of PDB entry 5RNT - ribonuclease T1 with guanosine-3',5'-diphosphate and phosphate ion bound
5RNT 1993-01-15 3.2 X-RAY ANALYSIS OF CUBIC CRYSTALS OF THE COMPLEX FORMED BETWEEN RIBONUCLEASE T1 AND GUANOSINE-3',5'-BISPHOSPHATE

Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
96.0 Ribonuclease pancreatic Q29606 RNAS1_ORYLE
90.3 Ribonuclease pancreatic P00662 RNAS1_GIRCA
92.7 Ribonuclease pancreatic P00668 RNAS1_ANTAM
95.2 Ribonuclease pancreatic P00660 RNAS1_CONTA
93.5 Ribonuclease pancreatic P07848 RNAS1_EUDTH
96.0 Ribonuclease pancreatic P07847 RNAS1_AEPME
95.2 Ribonuclease pancreatic P00657 RNAS1_BUBBU
96.8 Ribonuclease pancreatic P67927 RNAS1_SHEEP
96.8 Ribonuclease pancreatic P67926 RNAS1_CAPHI
100.0 Ribonuclease pancreatic P61823 RNAS1_BOVIN
100.0 Ribonuclease pancreatic P61824 RNAS1_BISBI
100.0 Guanyl-specific ribonuclease T1 P00651 RNT1_ASPOR