Investigating the role of conserved residue Asp134 in Escherichia coli ribonuclease HI by site-directed random mutagenesis.


Abstract

The role of the conserved Asp134 residue in Escherichia coli ribonuclease HI, which is located at the center of the alpha V helix and lies close to the active site, was analyzed by means of site-directed random mutagenesis. Mutant rnhA genes encoding proteins with ribonuclease H activities were screened by their ability to suppress the ribonuclease-H-dependent, temperature-sensitive growth phenotype of E. coli strain MIC3001. Based on the DNA sequences, nine mutant proteins were predicted to have ribonuclease H activity in vivo. All of these mutant proteins were purified to homogeneity and examined for enzymic activity and protein stability. Among them, only the mutant proteins [D134H]RNase H and [D134N]RNase H were shown to have considerable ribonuclease H activities. Determination of the kinetic parameters revealed that replacement of Asp134 by amino acid residues other than asparagine and histidine dramatically decreased the enzymic activity without seriously affecting the substrate binding. Determination of the CD spectra indicated that none of the mutations seriously affected secondary and tertiary structure. The protein stability was determined from the thermal denaturation curves. All mutant proteins were more stable than the wild-type protein. Such stabilization effects would be a result of a reduction in the negative charge repulsion between Asp134 and the active-site residues, and/or an enhancement of the stability of the alpha V helix. These results strongly suggest that Asp134 does not contribute to the maintenance of the molecular architecture but the carboxyl oxygen at its delta 1 position impacts catalysis. Study holds ProTherm entries: 679, 680, 681, 682, 683, 684, 685, 686, 687, 688, 689, 690, 691, 692, 693, 694, 695, 696, 697, 698, 699, 700, 13351, 13352, 13353, 13354, 13355, 13356, 13357, 13358, 13359, 13360, 13361, 13362, 13363, 13364, 13365, 13366, 13367, 13368, 13369, 13370 Extra Details: Activity determined at 30 degree C

Submission Details

ID: xjXpvFLX3

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:15 p.m.

Version: 1

Publication Details
Haruki M;Noguchi E;Nakai C;Liu YY;Oobatake M;Itaya M;Kanaya S,Eur. J. Biochem. (1994) Investigating the role of conserved residue Asp134 in Escherichia coli ribonuclease HI by site-directed random mutagenesis. PMID:8125123
Additional Information

Study Summary

Number of data points 180
Proteins Ribonuclease HI ; Ribonuclease HI ; Ribonuclease HI ; Ribonuclease HI ; Ribonuclease HI
Unique complexes 11
Assays/Quantities/Protocols Experimental Assay: activity temp:50.0 C, pH:3.0, buffers:glycine-HCl: 10 mM ; Experimental Assay: activity_kcat temp:50.0 C, pH:3.0, buffers:glycine-HCl: 10 mM ; Experimental Assay: ddG temp:50.0 C, pH:3.0, buffers:glycine-HCl: 10 mM ; Experimental Assay: activity_km temp:50.0 C, pH:3.0, buffers:glycine-HCl: 10 mM ; Experimental Assay: activity pH:5.5, temp:53.1 C, buffers:Sodium acetate: 20 mM ; Experimental Assay: activity_kcat pH:5.5, temp:53.1 C, buffers:Sodium acetate: 20 mM ; Experimental Assay: ddG pH:5.5, temp:53.1 C, buffers:Sodium acetate: 20 mM ; Experimental Assay: activity_km pH:5.5, temp:53.1 C, buffers:Sodium acetate: 20 mM ; Experimental Assay: activity_kcat pH:3.0, buffers:glycine-HCl: 10 mM ; Experimental Assay: activity pH:3.0, buffers:glycine-HCl: 10 mM ; Experimental Assay: Tm pH:3.0, buffers:glycine-HCl: 10 mM ; Experimental Assay: dHvH pH:3.0, buffers:glycine-HCl: 10 mM ; Experimental Assay: activity_km pH:3.0, buffers:glycine-HCl: 10 mM ; Experimental Assay: activity_kcat pH:5.5, buffers:Sodium acetate: 20 mM ; Experimental Assay: activity pH:5.5, buffers:Sodium acetate: 20 mM ; Experimental Assay: Tm pH:5.5, buffers:Sodium acetate: 20 mM ; Experimental Assay: dHvH pH:5.5, buffers:Sodium acetate: 20 mM ; Experimental Assay: activity_km pH:5.5, buffers:Sodium acetate: 20 mM ; Derived Quantity: dTm pH:3.0, buffers:glycine-HCl: 10 mM ; Derived Quantity: dTm pH:5.5, buffers:Sodium acetate: 20 mM
Libraries Mutations for sequence MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
100.0 Ribonuclease HI A7ZHV1 RNH_ECO24
100.0 Ribonuclease HI B7MBJ0 RNH_ECO45
100.0 Ribonuclease HI P0A7Y6 RNH_ECO57
100.0 Ribonuclease HI B5Z0I8 RNH_ECO5E
100.0 Ribonuclease HI B7NKW4 RNH_ECO7I
100.0 Ribonuclease HI B7MQ23 RNH_ECO81
100.0 Ribonuclease HI B7M213 RNH_ECO8A
100.0 Ribonuclease HI C4ZRV1 RNH_ECOBW
100.0 Ribonuclease HI B1XD78 RNH_ECODH
100.0 Ribonuclease HI P0A7Y5 RNH_ECOL6
100.0 Ribonuclease HI B1IPU4 RNH_ECOLC
100.0 Ribonuclease HI P0A7Y4 RNH_ECOLI
100.0 Ribonuclease HI B7N876 RNH_ECOLU
100.0 Ribonuclease HI B6HZS7 RNH_ECOSE
100.0 Ribonuclease HI B1LHM3 RNH_ECOSM
100.0 Ribonuclease HI B7LW89 RNH_ESCF3
100.0 Ribonuclease HI B2U352 RNH_SHIB3
100.0 Ribonuclease HI Q325T2 RNH_SHIBS
100.0 Ribonuclease HI Q32JP9 RNH_SHIDS
100.0 Ribonuclease HI P0A7Y7 RNH_SHIFL
100.0 Ribonuclease HI Q3Z5E9 RNH_SHISS
99.4 Ribonuclease HI B7UJB0 RNH_ECO27
99.4 Ribonuclease HI B7LHC0 RNH_ECO55
99.4 Ribonuclease HI A7ZWF6 RNH_ECOHS
99.4 Ribonuclease HI Q0TLC3 RNH_ECOL5
93.5 Ribonuclease HI A8AKR0 RNH_CITK8
93.5 Ribonuclease HI B5F8X2 RNH_SALA4
93.5 Ribonuclease HI A9MPF1 RNH_SALAR
93.5 Ribonuclease HI Q57SZ6 RNH_SALCH
93.5 Ribonuclease HI B5FJ58 RNH_SALDC
93.5 Ribonuclease HI B5R449 RNH_SALEP
93.5 Ribonuclease HI B5R5L3 RNH_SALG2
93.5 Ribonuclease HI B4TK85 RNH_SALHS
93.5 Ribonuclease HI B4SV39 RNH_SALNS
93.5 Ribonuclease HI Q5PFD8 RNH_SALPA
93.5 Ribonuclease HI A9MZ19 RNH_SALPB
93.5 Ribonuclease HI B5BDW5 RNH_SALPK
93.5 Ribonuclease HI B4TYH0 RNH_SALSV
93.5 Ribonuclease HI P0A2C0 RNH_SALTI
93.5 Ribonuclease HI P0A2B9 RNH_SALTY
92.9 Ribonuclease HI C0Q6N2 RNH_SALPC
90.9 Ribonuclease HI B5Y1G2 RNH_KLEP3
90.9 Ribonuclease HI A6T512 RNH_KLEP7