Stabilization of hen egg white lysozyme by a cavity-filling mutation.
Abstract
Stabilization of a protein using cavity-filling strategy has hardly been successful because of unfavorable van der Waals contacts. We succeeded in stabilizing lysozymes by cavity-filling mutations. The mutations were checked by a simple energy minimization in advance. It was shown clearly that the sum of free energy change caused by the hydrophobicity and the cavity size was correlated very well with protein stability. We also considered the aromatic-aromatic interaction. It is reconfirmed that the cavity-filling mutation in a hydrophobic core is a very useful method to stabilize a protein when the mutation candidate is selected carefully. Study holds ProTherm entries: 12725, 12726, 12727, 12728, 12729, 12730, 14301, 14302, 14303, 14304, 14305 Extra Details: In the presence of 0.7 M GdnHCl. beta-trefoil; fibroblast growth factor; core-packing; protein engineering;,protein evolution
Submission Details
ID: xNVv77tw3
Submitter: Connie Wang
Submission Date: April 24, 2018, 8:44 p.m.
Version: 1
Publication Details
Ohmura T;Ueda T;Ootsuka K;Saito M;Imoto T,Protein Sci. (2001) Stabilization of hen egg white lysozyme by a cavity-filling mutation. PMID:11266617Additional Information
Study Summary
| Number of data points | 28 |
| Proteins | Fibroblast growth factor 1 ; Fibroblast growth factor 1 |
| Unique complexes | 6 |
| Assays/Quantities/Protocols | Experimental Assay: ddG ; Experimental Assay: dHcal ; Experimental Assay: Tm ; Experimental Assay: dHvH ; Derived Quantity: dTm |
| Libraries | Mutations for sequence FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Structure view and single mutant data analysis
Study data
| Colors: | D | E | R | H | K | S | T | N | Q | A | V | I | L | M | F | Y | W | C | G | P |
|---|
Data Distribution
Studies with similar sequences (approximate matches)
Correlation with other assays (exact sequence matches)
Relevant UniProtKB Entries
| Percent Identity | Matching Chains | Protein | Accession | Entry Name |
|---|---|---|---|---|
| 100.0 | Fibroblast growth factor 1 | P05230 | FGF1_HUMAN | |
| 100.0 | Fibroblast growth factor 1 | Q5NVQ3 | FGF1_PONAB | |
| 97.9 | Fibroblast growth factor 1 | P34004 | FGF1_MESAU | |
| 98.0 | Fibroblast growth factor 1 | P20002 | FGF1_PIG | |
| 96.4 | Fibroblast growth factor 1 | P61148 | FGF1_MOUSE | |
| 96.4 | Fibroblast growth factor 1 | P61149 | FGF1_RAT | |
| 92.3 | Fibroblast growth factor 1 | P03968 | FGF1_BOVIN | |
| 90.7 | Fibroblast growth factor 1 | Q7M303 | FGF1_SHEEP | |
| 90.3 | Fibroblast growth factor 1 | P19596 | FGF1_CHICK | |
| 91.5 | Fibroblast growth factor 1 | Q9N1S8 | FGF1_CAPCA |