Thermodynamic studies of the core histones: ionic strength and pH dependence of H2A-H2B dimer stability.


Abstract

The thermal stability of the core histone dimer H2A-H2B has been studied by high-sensitivity differential scanning calorimetry and circular dichroism spectroscopy. The unfolding transition temperature of the 28 kDa H2A-H2B dimer increases as a function of both the ionic strength of the solvent and the total protein concentration. At neutral pH and physiological ionic strength, the thermal denaturation is centered at about 50 degrees C with a corresponding enthalpy change of about 40 kcal/mol of 14 kDa monomer unit and an excess heat capacity of about 1.4 kcal/(K.mol) of 14 kDa monomer unit. The H2A-H2B dimer is stable mainly between pH 5.5 and 10.5. Below pH 4.0, the system is unfolded at all temperatures. The thermodynamic analysis is performed at low ionic strength where almost complete reversibility is attained, since higher salt conditions seem to promote aggregation and irreversibility of the transitions. Analysis of the data shows that at low ionic strength and pH values between 6.5 and 8.5, the H2A-H2B dimer behaves as a highly cooperative system, melting as a single unit without any detectable intermediates of dissociated, yet folded, H2A and H2B monomers. This is consistent with the observed protein concentration dependence of the midpoint of the thermal denaturation. The two-state unfolding process can be described by the general scheme AB-->2U, indicating that the individual H2A and H2B polypeptides are folded, stable entities only when complexed as the H2A-H2B dimer and that the major contribution to the stabilization of the dimer derives from the coupling between the H2A and H2B interfaces. Study holds ProTherm entries: 5382, 5383, 5384, 5385, 5386, 5387, 5388, 5389, 5390, 5391, 5392, 5393, 5394, 5395, 5396, 5397, 5398 Extra Details: ionic strength; pH dependence; protein concentration;,H2A-H2B dimer; heat capacity

Submission Details

ID: v3sYWqzr3

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:30 p.m.

Version: 1

Publication Details
Karantza V;Baxevanis AD;Freire E;Moudrianakis EN,Biochemistry (1995) Thermodynamic studies of the core histones: ionic strength and pH dependence of H2A-H2B dimer stability. PMID:7727455
Additional Information

Study Summary

Number of data points 32
Proteins Histone H2B 1/2/3/4/6 ; Histone H2A-IV
Unique complexes 1
Assays/Quantities/Protocols Experimental Assay: Tm buffers:CAPS: 7.5 mM, ionic:NaCl: 100 mM, pH:11.5 ; Experimental Assay: Tm buffers:CAPS: 7.5 mM, ionic:NaCl: 100 mM, pH:10.5 ; Experimental Assay: Tm buffers:bicine: 10 mM, ionic:NaCl: 100 mM, pH:9.5 ; Experimental Assay: dHvH buffers:bicine: 10 mM, pH:9.5 ; Experimental Assay: Tm buffers:bicine: 10 mM, ionic:NaCl: 100 mM, pH:8.5 ; Experimental Assay: dHvH buffers:bicine: 10 mM, pH:8.5 ; Experimental Assay: Tm pH:7.5, ionic:NaCl: 100 mM, buffers:HEPES: 10 mM ; Experimental Assay: dHvH pH:7.5, buffers:HEPES: 10 mM ; Experimental Assay: Tm ionic:NaCl: 100 mM, buffers:HEPES: 10 mM, pH:6.5 ; Experimental Assay: dHvH buffers:HEPES: 10 mM, pH:6.5 ; Experimental Assay: Tm buffers:MES: 10 mM, pH:5.5, ionic:NaCl: 100 mM ; Experimental Assay: dHvH buffers:MES: 10 mM, pH:5.5 ; Experimental Assay: Tm pH:4.5, ionic:NaCl: 100 mM, buffers:MES: 10 mM ; Experimental Assay: Tm buffers:glycine: 10 mM, pH:4.0, ionic:NaCl: 100 mM ; Experimental Assay: Tm ionic:NaCl: 50 mM, pH:11.5, buffers:glycine: 10 mM ; Experimental Assay: Tm ionic:NaCl: 50 mM, pH:10.5, buffers:glycine: 10 mM ; Experimental Assay: dCp buffers:glycine: 10 mM, pH:9.5 ; Experimental Assay: dHcal buffers:glycine: 10 mM, pH:9.5 ; Experimental Assay: Tm ionic:NaCl: 50 mM, pH:9.5, buffers:glycine: 10 mM ; Experimental Assay: dCp buffers:glycylglycine: 10 mM, pH:8.5 ; Experimental Assay: dHcal buffers:glycylglycine: 10 mM, pH:8.5 ; Experimental Assay: Tm ionic:NaCl: 50 mM, pH:8.5, buffers:glycylglycine: 10 mM ; Experimental Assay: dCp pH:7.5, buffers:imidazole: 10 mM ; Experimental Assay: dHcal pH:7.5, buffers:imidazole: 10 mM ; Experimental Assay: Tm pH:7.5, buffers:imidazole: 10 mM, ionic:NaCl: 50 mM ; Experimental Assay: dCp buffers:imidazole: 10 mM, pH:6.5 ; Experimental Assay: dHcal buffers:imidazole: 10 mM, pH:6.5 ; Experimental Assay: Tm buffers:imidazole: 10 mM, pH:6.5, ionic:NaCl: 50 mM ; Experimental Assay: dCp pH:5.5, buffers:imidazole: 10 mM ; Experimental Assay: dHcal pH:5.5, buffers:imidazole: 10 mM ; Experimental Assay: Tm buffers:imidazole: 10 mM, pH:5.5, ionic:NaCl: 50 mM ; Experimental Assay: Tm pH:4.5, buffers:glycylglycine: 10 mM, ionic:NaCl: 50 mM
Libraries Mutations for sequence A:KSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP/B:SYSIYVYKVLKQVHPDTGISSKAMGSMNSFVNDIFERIAGLASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKHTSSK/C:PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIELARRIRGERA/D:QGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant PDB Entries

Structure ID Release Date Resolution Structure Title
2KWO 2010-07-14 Solution structure of the double PHD (plant homeodomain) fingers of human transcriptional protein DPF3b bound to a histone H4 peptide containing N-terminal acetylation at Serine 1
1CT6 1999-09-02 SOLUTION STRUCTURE OF CGGIRGERG IN CONTACT WITH THE MONOCLONAL ANTIBODY MAB 4X11, NMR, 11 STRUCTURES
5VEY 2017-05-17 Solution NMR structure of histone H2A-H2B mono-ubiquitylated at H2A Lys15 in complex with RNF169 (653-708)
2LBM 2011-06-29 Solution structure of the ADD domain of ATRX complexed with histone tail H3 1-15 K9me3
4BD3 2012-10-31 Phf19 links methylated lysine 36 of histone H3 to regulation of Polycomb activity
2L43 2011-08-31 Structural basis for histone code recognition by BRPF2-PHD1 finger
2IIJ 2007-02-13 Structure of human Asf1a in complex with histone H3
2RS9 2012-12-12 Solution structure of the bromodomain of human BRPF1 in complex with histone H4K5ac peptide
2L5A 2011-03-16 Structural basis for recognition of centromere specific histone H3 variant by nonhistone Scm3
2M0O 2013-01-16 The solution structure of human PHF1 in complex with H3K36me3
6E83 2018-09-19 Solution structure of ZZZ3 ZZ domain in complex with histone H3 tail
6O22 2019-07-31 Structure of Asf1-H3:H4-Rtt109-Vps75 histone chaperone-lysine acetyltransferase complex with the histone substrate.
2LVM 2012-12-12 Solution structure of human 53BP1 tandem Tudor domains in complex with a histone H4K20me2 peptide
1GUW 2002-03-12 STRUCTURE OF THE CHROMODOMAIN FROM MOUSE HP1beta IN COMPLEX WITH THE LYSINE 9-METHYL HISTONE H3 N-TERMINAL PEPTIDE, NMR, 25 STRUCTURES
2L75 2011-01-19 Solution structure of CHD4-PHD2 in complex with H3K9me3
2NDG 2016-09-07 Solution NMR structures of AF9 yeats domain in complex with histone H3 crotonylation at K18
2RNY 2008-05-06 Complex Structures of CBP Bromodomain with H4 ack20 Peptide
2KWJ 2010-07-14 Solution structures of the double PHD fingers of human transcriptional protein DPF3 bound to a histone peptide containing acetylation at lysine 14
6HBO 2018-09-05 Solution structure of the ASHH2 CW domain with the N-terminal histone H3 tail mimicking peptide monomethylated on lysine 4
1CS9 1999-09-02 SOLUTION STRUCTURE OF CGGIRGERA IN CONTACT WITH THE MONOCLONAL ANTIBODY MAB 4X11, NMR, 7 STRUCTURES
2NDF 2016-09-07 Solution NMR structures of AF9 yeats domain in complex with histon H3 acetylation at K18
6E86 2018-09-19 Solution structure of ZZZ3 ZZ domain in complex with histone H3K4ac peptide
2RVN 2016-03-16 Solution structure of the chromodomain of HP1a with the phosphorylated N-terminal tail complexed with H3K9me3 peptide
2KWK 2010-07-14 Solution structures of the double PHD fingers of human transcriptional protein DPF3b bound to a H3 peptide wild type
2RVQ 2016-05-25 Solution structure of the isolated histone H2A-H2B heterodimer
2KWN 2010-07-14 Solution structure of the double PHD (plant homeodomain) fingers of human transcriptional protein DPF3b bound to a histone H4 peptide containing acetylation at Lysine 16
5TBN 2016-10-12 Solution NMR structure of PHF20 PHD domain in complex with a histone H3K4me2 peptide
3QL9 2011-06-15 0.93 Monoclinic complex structure of ATRX ADD bound to histone H3K9me3 peptide
5SVY 2016-10-05 1.05 MORC3 CW in complex with histone H3K4me1
2V89 2007-12-11 1.1 Crystal structure of RAG2-PHD finger in complex with H3K4me3 peptide at 1.1A resolution
5SZC 2017-08-16 1.19 Structure of human Dpf3 double-PHD domain bound to histone H3 tail peptide with monomethylated K4 and acetylated K14
5SZB 2017-08-16 1.2 Structure of human Dpf3 double-PHD domain bound to histone H3 tail peptide with acetylated K14
3F9X 2008-11-25 1.25 Structural Insights into Lysine Multiple Methylation by SET Domain Methyltransferases, SET8-Y334F / H4-Lys20me2 / AdoHcy
6BHD 2017-12-06 1.25 Crystal structure of SETDB1 with a modified H3 peptide
6AT0 2017-12-06 1.28 Chromodomain HP1 with a p-nitro-L-phenylalanine mutation at position 24 bound to histone H3 peptide containing trimethyl lysine
4UP0 2014-11-05 1.28 Ternary crystal structure of the Pygo2 PHD finger in complex with the B9L HD1 domain and a H3K4me2 peptide
5FFV 2015-12-30 1.3 Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone peptide
5WXH 2017-08-16 1.3 Crystal structure of TAF3 PHD finger bound to H3K4me3
5TEG 2016-12-07 1.3 Crystal structure of hSETD8 in complex with histone H4K20 norleucine mutant peptide and S-Adenosylmethionine
6BHE 2017-12-06 1.35 Crystal structure of SETDB1 with a modified H3 peptide
4L7X 2013-07-24 1.35 Crystal structure of the DIDO PHD finger in complex with H3K4me3
3UVW 2012-01-18 1.37 Crystal Structure of the first bromodomain of human BRD4 in complex with a diacetylated histone 4 peptide (H4K5acK8ac)
1PFB 2003-10-07 1.4 Structural Basis for specific binding of polycomb chromodomain to histone H3 methylated at K27
6BHI 2017-12-06 1.4 Crystal structure of SETDB1 with a modified H3 peptide
3ASL 2012-01-25 1.41 Structure of UHRF1 in complex with histone tail
5TDR 2016-11-02 1.42 Set3 PHD finger in complex with histone H3K4me2
2RI7 2007-12-11 1.45 Crystal structure of PHD finger-linker-bromodomain Y17E mutant from human BPTF in the H3(1-9)K4ME2 bound state
5GH9 2017-06-21 1.45 Crystal structure of CBP Bromodomain with H3K56ac peptide
1ZKK 2005-06-07 1.45 Crystal structure of hSET8 in ternary complex with H4 peptide (16-24) and AdoHcy
6BHG 2017-12-06 1.45 Crystal structure of SETDB1 with a modified H3 peptide
4YY6 2015-09-16 1.45 Crystal structure of BRD9 Bromodomain bound to a butyryllysine peptide
4X3K 2015-03-04 1.45 Crystal structure of chromobox homolog 7 (CBX7) chromodomain with H3K27me3 peptide
3V43 2012-06-27 1.47 Crystal structure of MOZ
4GNE 2013-01-02 1.47 Crystal Structure of NSD3 tandem PHD5-C5HCH domains complexed with H3 peptide 1-7
3MP6 2011-05-04 1.48 Complex Structure of Sgf29 and dimethylated H3K4
4CAY 2014-01-22 1.48 Crystal structure of a human Anp32e-H2A.Z-H2B complex
4L58 2013-06-26 1.48 Crystal structure of the MLL5 PHD finger in complex with H3K4me3
5JIY 2016-09-14 1.48 Structure of G9a SET-domain with Histone H3K9norLeucine mutant peptide and bound S-adenosylmethionine
1Q1A 2003-11-18 1.5 Structure of the yeast Hst2 protein deacetylase in ternary complex with 2'-O-acetyl ADP ribose and histone peptide
5JLB 2016-11-02 1.5 Crystal structure of SETD2 bound to histone H3.3 K36I peptide
4YYI 2015-09-16 1.5 Crystal structure of BRD9 Bromodomain bound to an acetylated peptide
3QZT 2011-06-01 1.5 Crystal Structure of BPTF bromo in complex with histone H4K16ac - Form II
3F9Y 2008-11-25 1.5 Structural Insights into Lysine Multiple Methylation by SET Domain Methyltransferases, SET8-Y334F / H4-Lys20me1 / AdoHcy
1SZD 2004-06-15 1.5 Structural basis for nicotinamide cleavage and ADP-ribose transfer by NAD+-dependent Sir2 histone/protein deacetylases
5CVE 2015-11-25 1.5 Crystal Structure of human NRMT1 in complex with dimethylated fly H2B peptide and SAH
5FFW 2015-12-30 1.5 Crystal structure of the bromodomain of human BRPF1 in complex with H4K5acK8ac histone peptide
4YYM 2015-09-16 1.5 Crystal structure of TAF1 BD2 Bromodomain bound to a butyryllysine peptide
2X4W 2010-04-21 1.5 Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.
3U3Z 2012-07-25 1.5 Structure of human microcephalin (MCPH1) tandem BRCT domains in complex with an H2A.X peptide phosphorylated at Ser139 and Tyr142
6ASZ 2017-12-06 1.52 Chromodomain HP1 with Y24F mutation bound to histone H3 peptide containing trimethyl lysine
4YYD 2015-09-16 1.52 Crystal structure of BRD9 Bromodomain bound to a crotonyllysine peptide
4GNF 2013-01-02 1.55 Crystal Structure of NSD3 tandem PHD5-C5HCH domains complexed with H3 peptide 1-15
3RIY 2011-11-23 1.55 Sirt5 is an NAD-dependent protein lysine demalonylase and desuccinylase
5SVX 2016-10-05 1.56 MORC3 CW in complex with histone H3K4me3
5YVX 2018-03-14 1.59 Crystal structure of SDG8 CW domain in complex with H3K4me1 peptide
5U2J 2017-04-12 1.6 MORF double PHD finger (DPF) in complex with histone H3K14bu
4Y6L 2016-01-06 1.6 Human SIRT2 in complex with myristoylated peptide (H3K9myr)
4QXB 2014-11-05 1.6 crystal structure of histone demethylase KDM2A-H3K36ME3 with NOG
3F9Z 2008-11-25 1.6 Structural Insights into Lysine Multiple Methylation by SET Domain Methyltransferases, SET8-Y245F / H4-Lys20 / AdoHcy
5T1I 2016-09-14 1.6 CBX3 chromo shadow domain in complex with histone H3 peptide
4LK9 2013-10-16 1.6 Crystal Structure of MOZ double PHD finger histone H3 tail complex
3F9W 2008-11-25 1.6 Structural Insights into Lysine Multiple Methylation by SET Domain Methyltransferases, SET8-Y334F / H4-Lys20 / AdoHcy
3QLA 2011-06-15 1.6 Hexagonal complex structure of ATRX ADD bound to H3K9me3 peptide
2VPG 2008-06-17 1.6 Decoding of methylated histone H3 tail by the Pygo-BCL9 Wnt signaling complex
4LKA 2013-10-16 1.61 Crystal Structure of MOZ double PHD finger histone H3K9ac complex
1Q3L 2004-10-12 1.64 Chromodomain Of HP1 Complexed With Histone H3 Tail Containing monomethyllysine 9.
3MUL 2010-08-11 1.65 Crystal structure of Brd4 bromodomain 1 with butyrylated histone H3-K(buty)14
4QX8 2014-11-05 1.65 Crystal structure of histone demethylase kdm2a-h3k36me3 complex with alpha-kg
4TWJ 2014-12-03 1.65 The structure of Sir2Af2 bound to a myristoylated histone peptide
4PLI 2015-07-22 1.65 Structure of the chromodomain of MRG2 in complex with H3K36me3
5JHN 2016-07-06 1.67 Structure of G9a SET-domain with Histone H3K9Ala mutant peptide and bound S-adenosylmethionine
4PL6 2015-07-22 1.68 Structure of the chromodomain of MRG2 in complex with H3K4me3
3MO8 2010-06-02 1.69 PWWP Domain of Human Bromodomain and PHD finger-containing protein 1 In Complex with Trimethylated H3K36 Peptide
2X4Y 2010-04-21 1.7 Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.
5T0K 2016-10-05 1.7 Structure of G9a SET-domain with H3K9M mutant peptide and SAM
2IG0 2007-01-02 1.7 Structure of 53BP1/methylated histone peptide complex
4QUT 2014-07-30 1.7 Structure of the bromodomain of human ATPase family AAA domain-containing protein 2 (ATAD2) complexed with Histone H4-K(ac)12
4F56 2012-06-20 1.7 The bicyclic intermediate structure provides insights into the desuccinylation mechanism of SIRT5
5WXG 2017-08-16 1.7 Structure of TAF PHD finger domain binds to H3(1-15)K4ac
4MZG 2014-03-26 1.7 Crystal structure of human Spindlin1 bound to histone H3K4me3 peptide
5YE3 2018-08-22 1.7 Crystal structure of the complex of di-acetylated histone H4 and 2A7D9 Fab fragment
2HUE 2006-11-21 1.7 Structure of the H3-H4 chaperone Asf1 bound to histones H3 and H4
5LUG 2017-09-20 1.7 Crystal structure of human Spindlin-2B protein in complex with ART(M3L)QTA(2MR)KS peptide
5TDW 2016-10-19 1.7 Set3 PHD finger in complex with histone H3K4me3
3O36 2010-12-15 1.7 Crystal structure of TRIM24 PHD-Bromo complexed with H4(14-19)K16ac peptide
5VAB 2017-04-19 1.7 Crystal structure of ATXR5 PHD domain in complex with histone H3
5JJ0 2016-07-06 1.72 Structure of G9a SET-domain with Histone H3K9M peptide and excess SAH
4GNG 2013-01-02 1.73 Crystal Structure of NSD3 tandem PHD5-C5HCH domains complexed with H3K9me3 peptide
4YYH 2015-09-16 1.74 Crystal structure of BRD9 Bromodomain bound to a crotonyllysine peptide
5MR8 2018-01-17 1.74 Crystal structure of TRIM33 PHD-Bromodomain isoform B in complex with H3K9ac histone peptide
4QQ4 2014-08-20 1.75 CW-type zinc finger of MORC3 in complex with the amino terminus of histone H3
4QXC 2014-11-05 1.75 Crystal structure of histone demethylase KDM2A-H3K36ME2 with NOG
6MIQ 2018-11-14 1.75 Crystal structure of Taf14 YEATS domain in complex with histone H3K9bu
2XYI 2011-05-04 1.75 Crystal Structure of Nurf55 in complex with a H4 peptide
3MUK 2010-08-11 1.75 Crystal structure of Brd4 bromodomain 1 with propionylated histone H3-K(prop)23
4Z0R 2015-04-08 1.75 Crystal Structure of the CW domain of ZCWPW2 mutant F78R in complex with histone H3 peptide
1SZC 2004-06-15 1.75 Structural basis for nicotinamide cleavage and ADP-ribose transfer by NAD+-dependent Sir2 histone/protein deacetylases
1O9S 2003-02-06 1.75 Crystal structure of a ternary complex of the human histone methyltransferase SET7/9
3GV6 2009-04-21 1.76 Crystal Structure of human chromobox homolog 6 (CBX6) with H3K9 peptide
2VNF 2008-04-01 1.76 MOLECULAR BASIS OF HISTONE H3K4ME3 RECOGNITION BY ING4
1PDQ 2003-08-26 1.76 Polycomb chromodomain complexed with the histone H3 tail containing trimethyllysine 27.
3O35 2010-12-15 1.76 Crystal structure of TRIM24 PHD-Bromo complexed with H3(23-31)K27ac peptide
4O62 2014-03-26 1.78 CW-type zinc finger of ZCWPW2 in complex with the amino terminus of histone H3
3KMT 2010-11-10 1.78 Crystal structure of vSET/SAH/H3 ternary complex
4TWI 2014-12-03 1.79 The structure of Sir2Af1 bound to a succinylated histone peptide
4YYK 2015-09-16 1.79 Crystal structure of BRD9 Bromodomain bound to a crotonyllysine peptide
4QBS 2015-05-13 1.8 Crystal structure of DNMT3a ADD domain E545R mutant bound to H3T3ph peptide
4HON 2012-11-21 1.8 Crystal structure of human JMJD2D/KDM4D in complex with an H3K9me3 peptide and 2-oxoglutarate
4QYL 2014-09-24 1.8 Crystal Structure of the human BRPF1 bromodomain in complex with a histone H2AK5ac peptide
3AVR 2011-10-19 1.8 Catalytic fragment of UTX/KDM6A bound with histone H3K27me3 peptide, N-oxyalylglycine, and Ni(II)
2V87 2007-12-11 1.8 Crystal structure of RAG2-PHD finger in complex with H3R2me2sK4me3 peptide
4U68 2015-08-05 1.8 Crystal structure of Rhino chromodomain in complex with H3K9me3
5YE4 2018-08-22 1.8 Crystal structure of the complex of di-acetylated histone H4 and 1A9D7 Fab fragment
3SOU 2011-08-03 1.8 Structure of UHRF1 PHD finger in complex with histone H3 1-9 peptide
4QUU 2014-07-30 1.8 Structure of the bromodomain of human ATPase family AAA domain-containing protein 2 (ATAD2) complexed with Histone H4-K(ac)5
3JVK 2009-10-13 1.8 Crystal structure of bromodomain 1 of mouse Brd4 in complex with histone H3-K(ac)14
6MLC 2018-10-24 1.8 PHD6 domain of MLL3 in complex with histone H4
3QZS 2011-06-01 1.8 Crystal Structure of BPTF bromo in complex with histone H4K16ac - Form I
4V2W 2014-11-26 1.81 JMJD2A COMPLEXED WITH NI(II), NOG AND HISTONE H3K27me3 PEPTIDE (16-35)
5NND 2018-05-16 1.82 Crystal Structure of the first bromodomain of human BRD4 in complex with a diacetylated histone 4 peptide (H3K9ac/K14ac)
6F6D 2018-10-17 1.82 The catalytic domain of KDM6B in complex with H3(17-33)K18IA21M peptide
4N4F 2014-02-19 1.83 Crystal Structure of the Bromodomain-PHD Finger Module of Human Transcriptional Co-Activator CBP in complex with di-Acetylated Histone 4 Peptide (H412acK16ac).
6BHH 2017-11-22 1.85 Crystal structure of SETDB1 with a modified H3 peptide
5I3L 2016-02-24 1.85 DPF3b in complex with H3K14ac peptide
4YYN 2015-09-16 1.85 Crystal structure of TAF1 BD2 Bromodomain bound to a crotonyllysine peptide
6MIO 2018-11-14 1.85 Crystal structure of Taf14 YEATS domain in complex with histone H3K9pr
4YYJ 2015-09-16 1.85 Crystal structure of BRD9 Bromodomain bound to a butyryllysine peptide
5JIN 2016-07-06 1.85 Structure of G9a SET-domain with Histone H3K9M mutant peptide and bound S-adenosylmethionine
2X4X 2010-04-21 1.85 Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.
4UY4 2014-09-24 1.86 1.86 A structure of human Spindlin-4 protein in complex with histone H3K4me3 peptide
2RJE 2007-10-30 1.86 Crystal structure of L3MBTL1 in complex with H4K20Me2 (residues 17-25), orthorhombic form II
1E6I 2000-11-24 1.87 Bromodomain from GCN5 complexed with acetylated H4 peptide
4LXL 2014-07-30 1.87 Crystal structure of JMJD2B complexed with pyridine-2,4-dicarboxylic acid and H3K9me3
1YDP 2005-03-08 1.9 1.9A crystal structure of HLA-G
1TZY 2004-08-03 1.9 Crystal Structure of the Core-Histone Octamer to 1.90 Angstrom Resolution
5HH7 2016-03-09 1.9 crystal structure of Arabidopsis ORC1b BAH-PHD cassette in complex with unmodified H3 peptide
4N3W 2014-01-29 1.9 Crystal Structure of the Bromodomain-PHD Finger Module of Human Transcriptional Co-Activator CBP in complex with Acetylated Histone 4 Peptide (H4K20ac).
3O34 2010-12-15 1.9 Crystal structure of TRIM24 PHD-Bromo complexed with H3(13-32)K23ac peptide
5T0M 2016-10-05 1.9 A histone H3K9M mutation traps histone methyltransferase Clr4 to prevent heterochromatin spreading
4QBR 2015-05-13 1.9 Crystal structure of DNMT3a ADD domain G550D mutant bound to H3 peptide
4OUC 2014-04-16 1.9 Structure of human haspin in complex with histone H3 substrate
4A7J 2012-01-11 1.9 Symmetric Dimethylation of H3 Arginine 2 is a Novel Histone Mark that Supports Euchromatin Maintenance
2H9M 2006-08-01 1.9 WDR5 in complex with unmodified H3K4 peptide
3LQJ 2010-07-07 1.9 Crystal structure of MLL1 PHD3-Bromo complexed with H3(1-9)K4me3 peptide
4I51 2012-12-19 1.9 Methyltransferase domain of HUMAN EUCHROMATIC HISTONE METHYLTRANSFERASE 1, mutant Y1211A
5ZWX 2018-11-14 1.9 Crystal structure of Raphanus sativus AGDP1 AGD12 in complex with an H3K9me2 peptide
6MIN 2018-11-14 1.9 Crystal structure of Taf14 YEATS domain G82A mutant in complex with histone H3K9cr
5T1G 2016-09-14 1.9 chromo shadow domain of CBX1 in complex with a histone peptide
3UVX 2012-01-25 1.91 Crystal Structure of the first bromodomain of human BRD4 in complex with a diacetylated histone 4 peptide (H4K12acK16ac)
2H9P 2006-08-01 1.91 WDR5 in complex with trimethylated H3K4 peptide
3LQI 2010-07-07 1.92 Crystal structure of MLL1 PHD3-Bromo complexed with H3(1-9)K4me2 peptide
6MIL 2018-11-14 1.93 Crystal structure of AF9 YEATS domain in complex with histone H3K9bu
1KX5 2002-12-25 1.94 X-Ray Structure of the Nucleosome Core Particle, NCP147, at 1.9 A Resolution
5BWN 2016-07-13 1.94 Crystal Structure of SIRT3 with a H3K9 Peptide Containing a Myristoyl Lysine
4QYD 2014-09-24 1.94 Crystal Structure of the human BRPF1 bromodomain in complex with a histone H4K12ac peptide
3ZVY 2011-12-07 1.95 PHD finger of human UHRF1 in complex with unmodified histone H3 N- terminal tail
4H9N 2012-10-10 1.95 Complex structure 1 of DAXX/H3.3(sub5)/H4
3SOW 2011-08-03 1.95 Structure of UHRF1 PHD finger in complex with histone H3K4me3 1-9 peptide
3T6R 2011-11-23 1.95 Structure of UHRF1 in complex with unmodified H3 N-terminal tail
4H9Q 2012-10-17 1.95 Complex structure 4 of DAXX(E225A)/H3.3(sub5)/H4
2OX0 2007-03-13 1.95 Crystal structure of JMJD2A complexed with histone H3 peptide dimethylated at Lys9
5WLE 2017-10-04 1.95 Crystal structure of the PPS PHD finger in complex with H3K4me3
3U5N 2012-01-18 1.95 Crystal structure of the complex of TRIM33 PHD-Bromo and H3(1-20)K9me3K14ac histone peptide
5VAC 2017-04-19 1.95 Crystal Structure of ATXR5 SET domain in complex with K36me3 histone H3 peptide
3QBY 2011-02-09 1.95 Crystal structure of the PWWP domain of human Hepatoma-derived growth factor 2
4DOW 2012-03-07 1.95 Structure of mouse ORC1 BAH domain bound to H4K20me2
5Y0D 2018-07-18 1.99 Crystal Structure of the human nucleosome containing the H2B E76K mutant
5B0Z 2016-01-27 1.99 The crystal structure of the nucleosome containing H3.2, at 1.98 A resolution
6G0L 2018-08-22 10.0 Structure of two molecules of the chromatin remodelling enzyme Chd1 bound to a nucleosome
2XQL 2010-11-03 19.5 Fitting of the H2A-H2B histones in the electron microscopy map of the complex Nucleoplasmin:H2A-H2B histones (1:5).
2V88 2007-12-11 2.0 Crystal structure of RAG2-PHD finger in complex with H3R2me2sK4me2 peptide
2C1N 2005-11-02 2.0 Molecular basis for the recognition of phosphorylated and phosphoacetylated histone H3 by 14-3-3
3O37 2010-12-15 2.0 Crystal structure of TRIM24 PHD-Bromo complexed with H3(1-10)K4 peptide
5WYI 2018-01-17 2.0 The Yaf9 YEATS domain Recognizing H3K122suc Peptide
2OQ6 2007-03-13 2.0 Crystal structure of JMJD2A complexed with histone H3 peptide trimethylated at Lys9
4N4I 2014-03-05 2.0 Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha in complex with histone H3.3K36me3
2V85 2007-12-11 2.0 Crystal structure of RAG2-PHD finger in complex with H3R2me1K4me3 peptide
2QQF 2007-10-09 2.0 Hst2 bound to ADP-HPD and Acetylated histone H4
2H9N 2006-08-01 2.0 WDR5 in complex with monomethylated H3K4 peptide
3QZV 2011-06-01 2.0 Crystal Structure of BPTF PHD-linker-bromo in complex with histone H4K12ac peptide
5WVO 2017-11-15 2.0 Crystal structure of DNMT1 RFTS domain in complex with K18/K23 mono-ubiquitylated histone H3
1KX3 2002-12-25 2.0 X-Ray Structure of the Nucleosome Core Particle, NCP146, at 2.0 A Resolution
4F4U 2012-06-20 2.0 The bicyclic intermediate structure provides insights into the desuccinylation mechanism of SIRT5
3RIG 2011-11-23 2.0 Sirt5 is an NAD-dependent protein lysine demalonylase and desuccinylase
5Z8L 2018-07-25 2.01 crystal structure of Arabidopsis thaliana EBS in complex with an H3K27me3 peptide
2YBP 2011-03-30 2.02 JMJD2A COMPLEXED WITH R-2-HYDROXYGLUTARATE AND HISTONE H3K36me3 PEPTIDE (30-41)
3UVY 2012-01-18 2.02 Crystal Structure of the first bromodomain of human BRD4 in complex with a diacetylated histone 4 peptide (H4K16acK20ac)
2DVQ 2007-08-07 2.04 Crystal structure analysis of the N-terminal bromodomain of human BRD2 complexed with acetylated histone H4 peptide
4H9O 2012-10-10 2.05 Complex structure 2 of DAXX/H3.3(sub5,G90M)/H4
5FWE 2016-04-06 2.05 JMJD2A COMPLEXED WITH NI(II), NOG AND HISTONE H4(1-15)R3me2s PEPTIDE
1S32 2004-05-11 2.05 Molecular Recognition of the Nucleosomal 'Supergroove'
5DX0 2015-11-25 2.05 Crystal structure of CARM1, sinefungin, and H3 peptide (R17)
3JPX 2009-10-20 2.05 EED: A Novel Histone Trimethyllysine Binder Within The EED-EZH2 Polycomb Complex
2V86 2007-12-11 2.05 Crystal structure of RAG2-PHD finger in complex with H3R2me2aK4me3 peptide
2QQG 2007-10-09 2.05 Hst2 bound to ADP-HPD, acetyllated histone H4 and nicotinamide
5JJY 2016-11-02 2.05 Crystal structure of SETD2 bound to histone H3.3 K36M peptide
3R93 2011-04-06 2.06 Crystal structure of the chromo domain of M-phase phosphoprotein 8 bound to H3K9Me3 peptide
4GQB 2012-10-17 2.06 Crystal Structure of the human PRMT5:MEP50 Complex
4AU7 2013-05-22 2.07 The structure of the Suv4-20h2 ternary complex with histone H4
3UTA 2012-04-11 2.07 Crystal Structure of Nucleosome Core Particle Assembled with an Alpha-Satellite Sequence Containing Two TTAAA elements (NCP-TA2)
5Y0C 2018-07-18 2.09 Crystal Structure of the human nucleosome at 2.09 angstrom resolution
4YYG 2015-09-16 2.1 Crystal structure of BRD9 Bromodomain bound to a butyryllysine peptide
1KNA 2002-03-20 2.1 Chromo domain of HP1 complexed with histone H3 tail containing dimethyllysine 9.
2CNX 2006-07-03 2.1 WDR5 and Histone H3 Lysine 4 dimethyl complex at 2.1 angstrom
4MZF 2014-03-26 2.1 Crystal structure of human Spindlin1 bound to histone H3(K4me3-R8me2a) peptide
2WP1 2009-09-22 2.1 Structure of Brdt bromodomain 2 bound to an acetylated histone H3 peptide
3IJ1 2009-09-15 2.1 Crystal structure of Eed in complex with a trimethylated histone H4K20 peptide
3SHV 2011-12-28 2.1 Crystal structure of human MCPH1 tandem BRCT domains-gamma H2AX complex
3NQJ 2010-08-25 2.1 Crystal structure of (CENP-A/H4)2 heterotetramer
3TO6 2011-11-09 2.1 Crystal structure of yeast Esa1 HAT domain complexed with H4K16CoA bisubstrate inhibitor
5C13 2015-11-25 2.1 Crystal Structure of TAF3 PHD finger bound to histone H3C4me3 peptide
4QWN 2014-11-05 2.1 Histone demethylase KDM2A-H3K36ME1-alpha-KG complex structure
2ARO 2005-08-30 2.1 Crystal Structure Of The Native Histone Octamer To 2.1 Angstrom Resolution, Crystalised In The Presence Of S-Nitrosoglutathione
5VBC 2017-04-19 2.1 Crystal structure of ATXR5 in complex with histone H3.1
5IQL 2016-07-20 2.1 Crystal structure of YEATS2 YEATS bound to H3K27cr peptide
6BIZ 2018-01-17 2.1 HLA-DRB1 in complex with citrullinated Histone 2B peptide
5FB1 2016-05-04 2.1 Crystal Structure of a PHD finger bound to histone H3 K9me3 peptide
6D07 2019-04-10 2.1 Crystal structure of the complex between human chromobox homolog 1 (CBX1) and H3K9me3 peptide
6D08 2019-04-10 2.1 Crystal structure of an engineered bump-hole complex of mutant human chromobox homolog 1 (CBX1) with H3K9bn peptide
6IIT 2019-04-24 2.1 Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and an H3K36me2-containing histone peptide
5XTZ 2018-06-27 2.11 Crystal structure of GAS41 YEATS bound to H3K27ac peptide
2OT7 2007-03-13 2.13 Crystal structure of JMJD2A complexed with histone H3 peptide monomethylated at Lys9
5OY3 2017-09-20 2.14 The structural basis of the histone demethylase KDM6B histone 3 lysine 27 specificity
1HQ3 2001-01-24 2.15 CRYSTAL STRUCTURE OF THE HISTONE-CORE-OCTAMER IN KCL/PHOSPHATE
3SQD 2011-11-09 2.15 Crystal structure of human PTIP BRCT5/6-gamma H2AX complex
3U4S 2012-02-08 2.15 Histone Lysine demethylase JMJD2A in complex with T11C peptide substrate crosslinked to N-oxalyl-D-cysteine
5X7X 2017-04-19 2.18 The crystal structure of the nucleosome containing H3.3 at 2.18 angstrom resolution
3KV4 2009-12-22 2.19 Structure of PHF8 in complex with histone H3
4TN7 2015-05-13 2.2 Crystal structure of mouse KDM2A-H3K36ME-NO complex
3U31 2011-11-09 2.2 Plasmodium falciparum Sir2A preferentially hydrolyzes medium and long chain fatty acyl lysine
4QXH 2014-11-05 2.2 Crystal structure of histone demethylase KDM2A-H3K36ME1 with NOG
5AV8 2015-12-23 2.2 human nucleosome core particle
4H9R 2012-10-17 2.2 Complex structure 5 of DAXX(E225A)/H3.3(sub5,G90A)/H4
3C1B 2008-10-07 2.2 The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin structure
5AV9 2015-12-23 2.2 human nucleosome core particle
4MZH 2014-03-26 2.2 Crystal structure of human Spindlin1 bound to histone H3(K4me3-R8me2s) peptide
3ZG6 2013-04-03 2.2 The novel de-long chain fatty acid function of human sirt6
2H2H 2006-12-05 2.2 The Structural basis of sirtuin substrate specificity
2W5Z 2009-02-10 2.2 Ternary Complex of the Mixed Lineage Leukaemia (MLL1) SET Domain with the cofactor product S-Adenosylhomocysteine and histone peptide.
5B31 2016-08-03 2.2 The crystal structure of the heterotypic H2AZ/H2A nucleosome with H3.1.
4M38 2014-04-23 2.2 Crystal structure of Trypanosoma brucei protein arginine methyltransferase 7 complex with AdoHcy and histone H4 peptide
5AV6 2015-12-23 2.2 human nucleosome core particle
3UT9 2012-04-11 2.2 Crystal Structure of Nucleosome Core Particle Assembled with a Palindromic Widom '601' Derivative (NCP-601L)
3UTB 2012-04-11 2.2 Crystal Structure of Nucleosome Core Particle Assembled with the 146b Alpha-Satellite Sequence (NCP146b)
4H9P 2012-10-17 2.2 Complex structure 3 of DAXX/H3.3(sub5,G90A)/H4
5NNC 2018-05-16 2.22 Crystal Structure of the first bromodomain of human BRD4 in complex with a diacetylated histone 4 peptide (H3K9ac/K14ac)
4GUS 2013-01-16 2.23 Crystal structure of LSD2-NPAC with H3 in space group P3221
5CIU 2016-03-30 2.24 Structural basis of the recognition of H3K36me3 by DNMT3B PWWP domain
4ZBJ 2015-07-15 2.25 UBN1 peptide bound to H3.3/H4/Asf1
2CO0 2006-07-03 2.25 WDR5 and unmodified Histone H3 complex at 2.25 angstrom
5XFR 2017-09-13 2.25 Ternary complex of MTF2, DNA and histone
5M5G 2017-01-11 2.27 Crystal structure of the Chaetomium Thermophilum polycomb repressive complex 2 (PRC2)
5KJH 2017-04-19 2.27 Crystal structure of an active polycomb repressive complex 2 in the stimulated state
5WFC 2018-06-27 2.28 Humanized mutant of the Chaetomium thermophilum Polycomb Repressive Complex 2 bound to the inhibitor GSK343
5D6Y 2016-02-10 2.29 Crystal structure of double tudor domain of human lysine demethylase KDM4A complexed with histone H3K23me3
3A1B 2009-11-10 2.29 Crystal structure of the DNMT3A ADD domain in complex with histone H3
4YHZ 2016-02-10 2.3 Crystal structure of 304M3-B Fab in complex with H3K4me3 peptide
3N9N 2010-06-30 2.3 ceKDM7A from C.elegans, complex with H3K4me3K9me2 peptide and NOG
3MGR 2010-06-16 2.3 Binding of Rubidium ions to the Nucleosome Core Particle
2NQB 2007-09-11 2.3 Drosophila Nucleosome Structure
4N4H 2014-03-05 2.3 Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha in complex with histone H3.1K36me3
3QJ6 2011-02-23 2.3 The crystal structure of PWWP domain of human Hepatoma-derived growth factor 2 in complex with H3K79me3 peptide
2E3K 2007-12-11 2.3 Crystal structure of the human Brd2 second bromodomain in complexed with the acetylated histone H4 peptide
2DVR 2007-08-07 2.3 Crystal structure analysis of the N-terminal bromodomain of human BRD2 complexed with acetylated histone H4 peptide
4C1Q 2013-10-16 2.3 Crystal structure of the PRDM9 SET domain in complex with H3K4me2 and AdoHcy.
3UW9 2012-03-14 2.3 Crystal Structure of the first bromodomain of human BRD4 in complex with a diacetylated histone 4 peptide (H4K8acK12ac)
1M19 2003-02-18 2.3 LIGAND BINDING ALTERS THE STRUCTURE AND DYNAMICS OF NUCLEOSOMAL DNA
3N9Q 2010-06-30 2.3 ceKDM7A from C.elegans, complex with H3K4me3 peptide, H3K27me2 peptide and NOG
1P3I 2004-02-24 2.3 Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
4TMP 2014-11-05 2.3 Crystal structure of AF9 YEATS bound to H3K9ac peptide
3N9O 2010-06-30 2.31 ceKDM7A from C.elegans, complex with H3K4me3 peptide, H3K9me2 peptide and NOG
5BNX 2015-06-17 2.31 Crystal structure of Human MCM2 HBD and ASF1b chaperoning a histone H3.3-H4 dimer
5OMX 2017-11-15 2.32 X-ray Structure of the H2A-N38C Nucleosome Core Particle
2YBS 2011-03-30 2.32 JMJD2A COMPLEXED WITH S-2-HYDROXYGLUTARATE AND HISTONE H3K36me3 PEPTIDE (30-41)
5FA5 2016-02-24 2.34 Crystal Structure of PRMT5:MEP50 in complex with MTA and H4 peptide
4QX7 2014-11-05 2.34 Crystal structure of histone demethylase kdm2a-h3k36me2 with alpha-kg
5B1M 2017-02-15 2.34 The mouse nucleosome structure containing H3.1
4KHA 2013-05-29 2.35 Structural basis of histone H2A-H2B recognition by the essential chaperone FACT
4EO5 2012-06-13 2.35 Yeast Asf1 bound to H3/H4G94P mutant
5B32 2016-08-03 2.35 The crystal structure of the heterotypic H2AZ/H2A nucleosome with H3.3.
5B1L 2017-02-15 2.35 The mouse nucleosome structure containing H3t
6IIS 2019-04-24 2.36 Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and an H3K36me3-containing histone peptide
5DWQ 2015-11-25 2.36 Crystal structure of CARM1, sinefungin, and methylated H3 peptide (R17)
2WP2 2009-09-22 2.37 Structure of Brdt bromodomain BD1 bound to a diacetylated histone H4 peptide.
5BWO 2016-07-13 2.38 Crystal Structure of Human SIRT3 in Complex with a Palmitoyl H3K9 Peptide
4J8U 2013-04-17 2.38 X-ray structure of NCP145 with chlorido(eta-6-p-cymene)(N-phenyl-2-pyridinecarbothioamide)osmium(II)
6AXJ 2017-11-22 2.38 Crystal structure of the Yaf9 YEATS domain bound to H3K27ac
3N9P 2010-06-30 2.39 ceKDM7A from C.elegans, complex with H3K4me3K27me2 peptide and NOG
1P3L 2004-02-24 2.4 Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
3AZG 2011-09-21 2.4 Crystal Structure of Human Nucleosome Core Particle Containing H3K115Q mutation
5T8R 2017-04-05 2.4 Crystal structure of human BAZ2A PHD zinc finger in complex with unmodified H3 10-mer
2V83 2007-12-11 2.4 Crystal structure of RAG2-PHD finger in complex with H3K4me3 peptide
5VNB 2018-09-05 2.4 YEATS in complex with histone H3
2B2W 2005-12-27 2.4 Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing trimethyllysine 4
4XZQ 2015-10-14 2.4 Nucleosome disassembly by RSC and SWI/SNF is enhanced by H3 acetylation near the nucleosome dyad axis
5V22 2017-03-22 2.4 Crystal structure of human SETD2 SET-domain in complex with H3K36M peptide and SAH
5VA6 2017-04-19 2.4 CRYSTAL STRUCTURE OF ATXR5 IN COMPLEX WITH HISTONE H3.1 MONO-METHYLATED ON R26
5AV5 2015-12-23 2.4 human nucleosome core particle
5AVC 2015-12-23 2.4 human nucleosome core particle
5AVB 2015-12-23 2.4 human nucleosome core particle
1KNE 2002-03-20 2.4 Chromo domain of HP1 complexed with histone H3 tail containing trimethyllysine 9
3CFS 2008-06-10 2.4 Structural basis of the interaction of RbAp46/RbAp48 with histone H4
3UIG 2012-02-01 2.4 crystal structure of human Survivin in complex with T3 phosphorylated H3(1-15) peptide
3U3D 2011-11-09 2.4 Plasmodium falciparum Sir2A preferentially hydrolyzes medium and long chain fatty acyl lysine
3DB3 2008-09-16 2.4 Crystal structure of the tandem tudor domains of the E3 ubiquitin-protein ligase UHRF1 in complex with trimethylated histone H3-K9 peptide
5VAH 2017-04-05 2.4 Crystal structure of ATXR5 SET domain in complex with histone H3 di-methylated on R26
5XFQ 2017-09-13 2.4 Ternary complex of PHF1, a DNA duplex and a histone peptide
5F6K 2016-02-24 2.41 Crystal structure of the MLL3-Ash2L-RbBP5 complex
4J8W 2013-04-17 2.41 X-ray structure of NCP145 with chlorido(eta-6-p-cymene)(N-fluorophenyl-2-pyridinecarbothioamide)osmium(II)
4QBQ 2015-05-13 2.41 Crystal structure of DNMT3a ADD domain bound to H3 peptide
2AZM 2006-01-31 2.41 Crystal structure of the MDC1 brct repeat in complex with the histone tail of gamma-H2AX
5Y20 2018-01-24 2.41 Crystal structure of AL1 PHD finger bound to H3K4me3
5V21 2017-03-22 2.41 Crystal structure of human SETD2 SET-domain in complex with H3K36M peptide and SAM
5JA4 2016-06-15 2.42 Crystal structure of human TONSL and MCM2 HBDs binding to a histone H3-H4 tetramer
2PYO 2007-11-06 2.43 Drosophila nucleosome core
3MGP 2010-06-16 2.44 Binding of Cobalt ions to the Nucleosome Core Particle
2B2T 2005-12-27 2.45 Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing trimethyllysine 4 and phosphothreonine 3
3UEF 2012-03-07 2.45 Crystal structure of human Survivin bound to histone H3 (C2 space group).
4WU8 2015-09-02 2.45 Structure of trPtNAP-NCP145
6AZE 2018-09-19 2.45 Crystal Structure of the BPTF PHD-bromodomain module bound to H3KC4me3 methyl lysine analog
1M18 2003-02-18 2.45 LIGAND BINDING ALTERS THE STRUCTURE AND DYNAMICS OF NUCLEOSOMAL DNA
5Z30 2018-07-18 2.45 The crystal structure of the nucleosome containing a cancer-associated histone H2A.Z R80C mutant
3QO2 2011-04-06 2.49 Structural insights for MPP8 chromodomain interaction with histone H3 lysine 9
4U9W 2015-01-28 2.49 Crystal Structure of NatD bound to H4/H2A peptide and CoA
3REH 2012-03-14 2.5 2.5 Angstrom Crystal Structure of the Nucleosome Core Particle Assembled with a 145 bp Alpha-Satellite DNA (NCP145)
3LZ0 2010-09-15 2.5 Crystal Structure of Nucleosome Core Particle Composed of the Widom 601 DNA Sequence (orientation 1)
3NQU 2010-08-25 2.5 Crystal structure of partially trypsinized (CENP-A/H4)2 heterotetramer
1EQZ 2000-04-17 2.5 X-RAY STRUCTURE OF THE NUCLEOSOME CORE PARTICLE AT 2.5 A RESOLUTION
3LZ1 2010-09-15 2.5 Crystal Structure of Nucleosome Core Particle Composed of the Widom 601 DNA Sequence (orientation 2)
4Z66 2015-10-14 2.5 Nucleosome disassembly by RSC and SWI/SNF is enhanced by H3 acetylation near the nucleosome dyad axis
4IUR 2013-05-01 2.5 crystal structure of SHH1 SAWADEE domain in complex with H3K9me3 peptide
2CV5 2005-06-28 2.5 Crystal structure of human nucleosome core particle
3AV1 2011-06-01 2.5 The human nucleosome structure containing the histone variant H3.2
6GYT 2018-10-17 2.5 Transcription factor dimerization activates the p300 acetyltransferase
4LLB 2013-10-16 2.5 Crystal Structure of MOZ double PHD finger histone H3K14ac complex
5JRG 2017-03-08 2.5 Crystal structure of the nucleosome containing the DNA with tetrahydrofuran (THF)
3MNN 2011-04-06 2.5 A Ruthenium Antitumour Agent Forms Specific Histone Protein Adducts in the Nucleosome Core
2DYP 2006-11-07 2.5 Crystal Structure of LILRB2(LIR2/ILT4/CD85d) complexed with HLA-G
3QLC 2011-06-15 2.5 Complex structure of ATRX ADD domain bound to unmodified H3 1-15 peptide
3AFA 2010-05-26 2.5 The human nucleosome structure
4PSX 2014-07-09 2.51 Crystal structure of histone acetyltransferase complex
4GUR 2013-01-16 2.51 Crystal structure of LSD2-NPAC with H3 in space group P21
4EZH 2012-08-08 2.52 the crystal structure of KDM6B bound with H3K27me3 peptide
6MIM 2018-11-14 2.53 Crystal structure of AF9 YEATS domain Y78W mutant in complex with histone H3K9cr
4YHP 2016-02-10 2.53 Crystal structure of 309M3-B Fab in complex with H3K9me3 peptide
5Y2F 2018-11-07 2.53 Human SIRT6 in complex with allosteric activator MDL-801
5H6Q 2017-04-12 2.53 Crystal structure of LSD1-CoREST in complex with peptide 11
2YBA 2011-05-11 2.55 Crystal structure of Nurf55 in complex with histone H3
3REJ 2012-03-14 2.55 2.55 Angstrom Crystal Structure of the Nucleosome Core Particle Assembled with a 146 bp Alpha-Satellite DNA (NCP146b)
5B0Y 2016-01-27 2.56 Crystal structure of the nucleosome containing histone H3 with the crotonylated lysine 122
4J8V 2013-05-08 2.58 X-ray structure of NCP145 with bound chlorido(eta-6-p-cymene)(N-phenyl-2-pyridinecarbothioamide)ruthenium(II)
5ZBX 2019-02-13 2.58 The crystal structure of the nucleosome containing histone H3.1 CATD(V76Q, K77D)
4EDU 2012-09-19 2.58 The MBT repeats of human SCML2 in a complex with histone H2A peptide
6E0P 2019-05-22 2.6 Cryo-EM structure of the centromeric nucleosome (Native alpha satellite DNA) in complex with a single chain antibody fragment
5HJC 2016-04-20 2.6 BRD3 second bromodomain in complex with histone H3 acetylation at K18
4WU9 2015-09-02 2.6 Structure of cisPtNAP-NCP145
5IX1 2016-08-17 2.6 Crystal structure of mouse Morc3 ATPase-CW cassette in complex with AMPPNP and H3K4me3 peptide
5H6R 2017-04-12 2.6 Crystal structure of LSD1-CoREST in complex with peptide 13
4H9S 2012-10-17 2.6 Complex structure 6 of DAXX/H3.3(sub7)/H4
6IP4 2019-04-10 2.6 Crystal structure of Arabidopsis thaliana JMJ13 catalytic domain in complex with NOG and an H3K27me3 peptide
1KX4 2002-12-25 2.6 X-Ray Structure of the Nucleosome Core Particle, NCP146b, at 2.6 A Resolution
3UII 2012-02-01 2.6 crystal structure of human Survivin in complex with H3(1-10) peptide
5VGE 2017-06-07 2.6 Crystal structure of HLA-C*07:02 in complex with RYR peptide
4W5A 2015-01-21 2.6 Complex structure of ATRX ADD bound to H3K9me3S10ph peptide
6A7U 2019-02-27 2.6 Crystal structure of histone H2A.Bbd-H2B dimer
5XF3 2017-10-11 2.6 Nucleosome core particle with an adduct of a binuclear RAPTA (Ru-arene-phosphaadamantane) compound having a 1,2-diphenylethylenediamine linker (R,R-configuration)
4PLL 2015-07-22 2.6 Structure of the chromodaomain of MRG2 in complex with H3K36me3
2C1J 2005-11-02 2.6 Molecular basis for the recognition of phosphorylated and phosphoacetylated histone H3 by 14-3-3
5CP6 2016-06-01 2.6 Nucleosome Core Particle with Adducts from the Anticancer Compound, [(eta6-5,8,9,10-tetrahydroanthracene)Ru(ethylenediamine)Cl][PF6]
5B2J 2016-06-15 2.6 Human nucleosome containing CpG methylated DNA
1F66 2000-11-27 2.6 2.6 A CRYSTAL STRUCTURE OF A NUCLEOSOME CORE PARTICLE CONTAINING THE VARIANT HISTONE H2A.Z
3R45 2011-04-06 2.6 Structure of a CENP-A-Histone H4 Heterodimer in complex with chaperone HJURP
3REK 2012-03-14 2.6 2.6 Angstrom Crystal Structure of the Nucleosome Core Particle Assembled with a 146 bp Alpha-Satellite DNA (NCP146b) Derivatized with Oxaliplatin
5YC3 2018-01-24 2.6 Crystal structure of AL3 PHD finger bound to H3K4me2
3MP1 2011-05-04 2.6 Complex structure of Sgf29 and trimethylated H3K4
3CFV 2008-06-10 2.6 Structural basis of the interaction of RbAp46/RbAp48 with histone H4
3UEE 2012-03-07 2.61 Crystal structure of human Survivin K62A mutant bound to N-terminal histone H3
5DAH 2015-10-21 2.61 Crystal structure of PZP domain of human AF10 protein fused with Histone H3 peptide
4NFT 2014-04-09 2.61 Crystal structure of human lnkH2B-h2A.Z-Anp32e
6E0C 2019-05-22 2.63 Cryo-EM structure of the CENP-A nucleosome (W601) in complex with a single chain antibody fragment
5CPK 2015-10-28 2.63 Nucleosome containing methylated Sat2L DNA
5XF6 2017-10-11 2.63 Nucleosome core particle with an adduct of a binuclear RAPTA (Ru-arene-phosphaadamantane) compound having an ethylenediamine linker
5F99 2016-02-03 2.63 X-ray Structure of the MMTV-A Nucleosome Core Particle
3SZM 2011-11-30 2.63 STRUCTURE OF HUMAN MICROCEPHALIN (MCPH1) TANDEM BRCT DOMAINS IN COMPLEX WITH A GAMMA-H2AX PHOSPHOPEPTIDE
2NZD 2007-04-10 2.65 Nucleosome core particle containing 145 bp of DNA
3MGQ 2010-06-16 2.65 Binding of Nickel ions to the Nucleosome Core Particle
1M1A 2003-02-18 2.65 LIGAND BINDING ALTERS THE STRUCTURE AND DYNAMICS OF NUCLEOSOMAL DNA
3REI 2012-03-14 2.65 2.65 Angstrom Crystal Structure of the Nucleosome Core Particle Assembled with a 145 bp Alpha-Satellite DNA (NCP145) Derivatized with Triamminechloroplatinum(II) Chloride
2B2V 2005-12-27 2.65 Crystal structure analysis of human CHD1 chromodomains 1 and 2 bound to histone H3 resi 1-15 MeK4
3WTP 2014-12-03 2.67 Crystal Structure of the heterotypic nucleosome containing human CENP-A and H3.3
4KGC 2014-03-26 2.69 Nucleosome Core Particle Containing (ETA6-P-CYMENE)-(1, 2-ETHYLENEDIAMINE)-RUTHENIUM
5X60 2017-04-12 2.69 Crystal structure of LSD1-CoREST in complex with peptide 9
2IO5 2007-02-27 2.7 Crystal structure of the CIA- histone H3-H4 complex
3A6N 2010-05-26 2.7 The nucleosome containing a testis-specific histone variant, human H3T
3AZF 2011-09-21 2.7 Crystal Structure of Human Nucleosome Core Particle Containing H3K79Q mutation
5HJB 2016-04-20 2.7 AF9 YEATS in complex with histone H3 Crotonylation at K9
4FT4 2012-10-17 2.7 crystal structure of Zea mays ZMET2 in complex H3(1-32)K9me2 peptide and SAH
5YC4 2018-01-24 2.7 Crystal structure of AL3 PHD finger bound to H3K4me3
5XNV 2017-11-01 2.7 Crystal structure of YEATS2 YEATS bound to H3K27ac peptide
3REL 2012-03-14 2.7 2.7 Angstrom Crystal Structure of the Nucleosome Core Particle Assembled with a 146 bp Alpha-Satellite DNA (NCP146b) Derivatized with Triamminechloroplatinum(II) Chloride
4IUT 2013-05-01 2.7 crystal structure of SHH1 SAWADEE domain in complex with H3K9me2 peptide
1P34 2004-02-24 2.7 Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
3AZI 2011-09-21 2.7 Crystal Structure of Human Nucleosome Core Particle Containing H4K31Q mutation
2XL3 2010-08-04 2.7 WDR5 IN COMPLEX WITH AN RBBP5 PEPTIDE AND HISTONE H3 PEPTIDE
5J9S 2017-03-08 2.7 ENL YEATS in complex with histone H3 acetylation at K27
3AZL 2011-09-21 2.7 Crystal Structure of Human Nucleosome Core Particle Containing H4K77Q mutation
3U5O 2012-01-18 2.7 Crystal structure of the complex of TRIM33 PHD-Bromo and H3(1-22)K9me3K14acK18ac histone peptide
5FUG 2016-03-09 2.7 Crystal structure of a human YL1-H2A.Z-H2B complex
1P3P 2004-02-24 2.7 Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
5GTC 2017-06-28 2.7 Crystal structure of complex between DMAP-SH conjugated with a Kaposi's sarcoma herpesvirus LANA peptide (5-15) and nucleosome core particle
4FWF 2013-01-16 2.7 Complex structure of LSD2/AOF1/KDM1b with H3K4 mimic
3UIK 2012-02-01 2.7 crystal structure of human Survivin mutant K62Y/H80W in complex with H3(1-10) peptide
6N1Z 2019-03-20 2.7 Importin-9 bound to H2A-H2B
5FB0 2016-05-04 2.7 Crystal Structure of a PHD finger bound to histone H3 T3ph peptide
1P3G 2004-02-24 2.7 Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
4IUU 2013-05-01 2.7 Crystal structure of SHH1 SAWADEE domain in complex with H3K9me1 peptide
2UXN 2007-05-29 2.72 Structural Basis of Histone Demethylation by LSD1 Revealed by Suicide Inactivation
5Z23 2019-02-13 2.73 Crystal structure of the nucleosome containing a chimeric histone H3/CENP-A CATD
4A0N 2011-11-09 2.74 Crystal structure of Survivin bound to the phosphorylated N-terminal tail of histone H3
1P3O 2004-02-24 2.75 Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
3LJA 2010-04-14 2.75 Using Soft X-Rays for a Detailed Picture of Divalent Metal Binding in the Nucleosome
3N9L 2010-06-30 2.8 ceKDM7A from C.elegans, complex with H3K4me3 peptide and NOG
5BNV 2015-06-17 2.8 Crystal structure of Human MCM2 HBD chaperoning a histone H3-H4 tetramer
4A0J 2011-11-09 2.8 Crystal structure of Survivin bound to the phosphorylated N-terminal tail of histone H3
5C11 2015-11-25 2.8 Crystal Structure of Jarid1a PHD finger bound to histone H3C4me3 peptide
5DNN 2016-09-14 2.8 Nucleosome core particle containing adducts of gold(I)-triethylphosphane and ruthenium(II)-toluene PTA complexes
3WKJ 2014-04-09 2.8 The nucleosome containing human TSH2B
5ONG 2017-11-22 2.8 X-Ray crystal structure of a nucleosome core particle with its DNA site-specifically crosslinked to the histone octamer
5MLU 2017-05-10 2.8 Crystal structure of the PFV GAG CBS bound to a mononucleosome
3U5P 2012-01-18 2.8 Crystal structure of the complex of TRIM33 PHD-Bromo and H3(1-28)K9me3K14acK18acK23ac histone peptide
1AOI 1998-09-30 2.8 COMPLEX BETWEEN NUCLEOSOME CORE PARTICLE (H3,H4,H2A,H2B) AND 146 BP LONG DNA FRAGMENT
5ONW 2017-11-22 2.8 X-Ray crystal structure of a nucleosome core particle with its DNA site-specifically crosslinked to the histone octamer and the two H2A/H2B dimers crosslinked via H2A N38C
4Z5T 2016-02-10 2.8 The nucleosome containing human H3.5
4IUV 2013-05-01 2.8 crystal structure of SHH1 SAWADEE domain in complex with H3K4me1K9me1 peptide
4HGA 2012-11-07 2.8 Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX
5ZNP 2018-07-18 2.8 Crystal structure of PtSHL in complex with an H3K4me3 peptide
3AV2 2011-06-01 2.8 The human nucleosome structure containing the histone variant H3.3
5AY8 2016-04-06 2.8 Crystal structure of human nucleosome containing H3.Y
5HJD 2016-04-20 2.81 AF9 YEATS in complex with histone H3 Crotonylation at K18
3X1T 2015-09-23 2.81 Crystal structure of nucleosome core particle consisting of mouse testis specific histone variants H2aa and H2ba
3X1S 2015-09-23 2.81 Crystal structure of the nucleosome core particle
5DNM 2016-09-14 2.81 Nucleosome core particle containing adducts of ruthenium(II)-toluene PTA complex
5E5A 2016-02-03 2.81 Crystal structure of the chromatin-tethering domain of Human cytomegalovirus IE1 protein bound to the nucleosome core particle
5XF5 2017-10-11 2.82 Nucleosome core particle with an adduct of a binuclear RAPTA (Ru-arene-phosphaadamantane) compound having a 1,2-diphenylethylenediamine linker (R,S-configuration)
2QQS 2007-12-11 2.82 JMJD2A tandem tudor domains in complex with a trimethylated histone H4-K20 peptide
5W0V 2017-11-01 2.82 Crystal structure of full-length Kluyveromyces lactis Kap123 with histone H4 1-34
5GT0 2017-02-15 2.82 Crystal structure of nucleosome complex with human testis-specific histone variants, Th2a
5GXQ 2017-04-19 2.85 The crystal structure of the nucleosome containing H3.6
5XF4 2017-10-11 2.87 Nucleosome core particle with an adduct of a binuclear RAPTA (Ru-arene-phosphaadamantane) compound having a 1,2-diphenylethylenediamine linker (S,S-configuration)
5XM0 2018-03-07 2.87 The mouse nucleosome structure containing H2A, H2B type3-A, H3.3, and H4
4J8X 2013-05-08 2.87 X-ray structure of NCP145 with bound chlorido(eta-6-p-cymene)(N-fluorophenyl-2-pyridinecarbothioamide)ruthenium(II)
3AZJ 2011-09-21 2.89 Crystal Structure of Human Nucleosome Core Particle Containing H4K44Q mutation
3AZM 2011-09-21 2.89 Crystal Structure of Human Nucleosome Core Particle Containing H4K79Q mutation
5IX2 2016-08-17 2.9 Crystal structure of mouse Morc3 ATPase-CW cassette in complex with AMPPNP and unmodified H3 peptide
5ZGC 2019-04-03 2.9 Crystal Structure of SIRT3 in complex with H4K16bhb peptide
5YKO 2017-12-27 2.9 Crystal structure of Arabidopsis thaliana JMJ14 catalytic domain in complex with NOG and H3K4me3 peptide
3MVD 2010-08-25 2.9 Crystal structure of the chromatin factor RCC1 in complex with the nucleosome core particle
4U7T 2014-11-12 2.9 Crystal structure of DNMT3A-DNMT3L in complex with histone H3
1P3M 2004-02-24 2.9 Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
2F8N 2006-05-23 2.9 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes
1ZLA 2006-02-28 2.9 X-ray Structure of a Kaposi's sarcoma herpesvirus LANA peptide bound to the nucleosomal core
3KUY 2010-01-05 2.9 DNA Stretching in the Nucleosome Facilitates Alkylation by an Intercalating Antitumor Agent
5CPI 2015-10-28 2.9 Nucleosome containing unmethylated Sat2R DNA
4UUZ 2015-02-11 2.9 MCM2-histone complex
1P3K 2004-02-24 2.9 Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
3ASK 2012-01-25 2.9 Structure of UHRF1 in complex with histone tail
1P3F 2004-02-24 2.9 Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
3AYW 2011-09-21 2.9 Crystal Structure of Human Nucleosome Core Particle Containing H3K56Q mutation
5GT3 2017-02-15 2.91 Crystal structure of nucleosome particle in the presence of human testis-specific histone variant, hTh2b
5BO0 2015-06-17 2.91 Crystal structure of Human MCM2 HBD and ASF1b chaperoning a histone H3.2-H4 dimer
5B33 2016-08-03 2.92 The crystal structure of the H2AZ nucleosome with H3.3.
3X1V 2015-09-23 2.92 Crystal structure of nucleosome core particle in the presence of histone variant involved in reprogramming
5KKL 2017-04-19 2.94 Structure of ctPRC2 in complex with H3K27me3 and H3K27M
2B2U 2005-12-27 2.95 Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing trimethyllysine 4 and dimethylarginine 2
5HYN 2016-05-11 2.95 Structure of Human Polycomb Repressive Complex 2 (PRC2) with oncogenic histone H3K27M peptide
3LEL 2010-05-19 2.95 Structural Insight into the Sequence-Dependence of Nucleosome Positioning
6NJ9 2019-02-20 2.96 Active state Dot1L bound to the H2B-Ubiquitinated nucleosome, 2-to-1 complex
4GY5 2012-11-14 2.96 Crystal structure of the tandem tudor domain and plant homeodomain of UHRF1 with Histone H3K9me3
4Z2M 2016-03-09 2.98 Crystal structure of human SPT16 Mid-AID/H3-H4 tetramer FACT Histone complex
3B95 2008-02-12 2.99 EuHMT1 (Glp) Ankyrin Repeat Domain (Structure 2)
6DZT 2019-05-22 2.99 Cryo-EM structure of nucleosome in complex with a single chain antibody fragment
3C9K 2009-01-06 20.0 Model of Histone Octamer Tubular Crystals
3AZN 2011-09-21 3.0 Crystal Structure of Human Nucleosome Core Particle Containing H4K91Q mutation
3W96 2013-08-28 3.0 Crystal Structure of Human Nucleosome Core Particle lacking H2A N-terminal region
3W99 2013-08-28 3.0 Crystal Structure of Human Nucleosome Core Particle lacking H4 N-terminal region
1P3B 2004-02-24 3.0 Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
3AZE 2011-09-21 3.0 Crystal Structure of Human Nucleosome Core Particle Containing H3K64Q mutation
3TU4 2011-11-23 3.0 Crystal structure of the Sir3 BAH domain in complex with a nucleosome core particle.
5B2I 2016-06-15 3.0 Human nucleosome containing CpG unmethylated DNA
4YS3 2015-10-14 3.0 Nucleosome disassembly by RSC and SWI/SNF is enhanced by H3 acetylation near the nucleosome dyad axis
2X0L 2010-03-02 3.0 Crystal structure of a neuro-specific splicing variant of human histone lysine demethylase LSD1.
1U35 2005-09-27 3.0 Crystal structure of the nucleosome core particle containing the histone domain of macroH2A
1P3A 2004-02-24 3.0 Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
5J3V 2016-09-21 3.05 Crystal structure of human Karyopherin-beta2 bound to the histone H3 tail
3WA9 2013-12-18 3.07 The nucleosome containing human H2A.Z.1
4JJN 2013-05-15 3.09 Crystal structure of heterochromatin protein Sir3 in complex with a silenced yeast nucleosome
5Z8N 2018-07-25 3.1 Crystal structure of Arabidopsis thaliana EBS C-terminal deletion construct in complex with an H3K4me2 peptide
5GSU 2017-02-15 3.1 Crystal structure of nucleosome core particle consisting of human testis-specific histone variants, Th2A and Th2B
1HIO 1998-11-25 3.1 HISTONE OCTAMER (CHICKEN), CHROMOSOMAL PROTEIN, ALPHA CARBONS ONLY
6SEG 2019-08-14 3.1 Class1: CENP-A nucleosome in complex with CENP-C central region
2HIO 2000-01-12 3.1 HISTONE OCTAMER (CHICKEN), CHROMOSOMAL PROTEIN
4GU0 2013-02-13 3.1 Crystal structure of LSD2 with H3
1ID3 2001-09-28 3.1 CRYSTAL STRUCTURE OF THE YEAST NUCLEOSOME CORE PARTICLE REVEALS FUNDAMENTAL DIFFERENCES IN INTER-NUCLEOSOME INTERACTIONS
2V1D 2007-05-29 3.1 Structural basis of LSD1-CoREST selectivity in histone H3 recognition
5GSE 2017-05-03 3.14 Crystal structure of unusual nucleosome
3MGS 2010-06-16 3.15 Binding of Cesium ions to the Nucleosome Core particle
3C1C 2008-10-07 3.15 The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin structure
5CPJ 2015-10-28 3.15 Nucleosome containing methylated Sat2R DNA
4XUJ 2016-01-27 3.18 Nucleosome core particle containing adducts from treatment with a thiomorpholine-substituted [(eta-6-p-cymene)Ru(3-hydroxy-2-pyridone)Cl] compound
4KUD 2013-08-07 3.2 Crystal structure of N-terminal acetylated Sir3 BAH domain D205N mutant in complex with yeast nucleosome core particle
5ZNR 2018-07-18 3.2 Crystal structure of PtSHL in complex with an H3K27me3 peptide
3WAA 2013-12-18 3.2 The nucleosome containing human H2A.Z.2
3KXB 2010-06-23 3.2 Structural characterization of H3K56Q nucleosomes and nucleosomal arrays
3W97 2013-08-28 3.2 Crystal Structure of Human Nucleosome Core Particle lacking H2B N-terminal region
3C9C 2008-05-13 3.2 Structural Basis of Histone H4 Recognition by p55
2D31 2006-03-14 3.2 Crystal structure of disulfide-linked HLA-G dimer
4FT2 2012-10-17 3.2 crystal structure of Zea mays ZMET2 in complex H3(1-15)K9me2 peptide and SAH
2FJ7 2006-09-26 3.2 Crystal structure of Nucleosome Core Particle Containing a Poly (dA.dT) Sequence Element
3AZK 2011-09-21 3.2 Crystal Structure of Human Nucleosome Core Particle Containing H4K59Q mutation
3O62 2011-01-05 3.22 Nucleosome core particle modified with a cisplatin 1,3-cis-{Pt(NH3)2}2+-d(GpTpG) intrastrand cross-link
5XBK 2018-02-14 3.22 Crystal structure of human Importin4
3X1U 2015-09-23 3.25 Crystal structure of nucleosome core particle in the presence of histone variants involved in reprogramming
4R8P 2014-11-05 3.28 Crystal structure of the Ring1B/Bmi1/UbcH5c PRC1 ubiquitylation module bound to the nucleosome core particle
6OM3 2019-07-10 3.3 Crystal structure of the Orc1 BAH domain in complex with a nucleosome core particle
5BS7 2015-07-08 3.3 Structure of histone H3/H4 in complex with Spt2
4LD9 2013-08-14 3.31 Crystal structure of the N-terminally acetylated BAH domain of Sir3 bound to the nucleosome core particle
5B40 2016-06-22 3.33 The nucleosome structure containing H2B-K120 and H4-K31 monoubiquitinations
6JYL 2019-05-29 3.37 The crosslinked complex of ISWI-nucleosome in the ADP.BeF-bound state
6O1D 2019-05-22 3.39 Cryo-EM structure of the centromeric nucleosome with native alpha satellite DNA
6IRO 2019-04-03 3.4 the crosslinked complex of ISWI-nucleosome in the ADP-bound state
3W98 2013-08-28 3.42 Crystal Structure of Human Nucleosome Core Particle lacking H3.1 N-terminal region
5XM1 2018-03-07 3.45 The mouse nucleosome structure containing H2A, H2B type3-A, H3mm7, and H4
3B6F 2007-12-25 3.45 Nucleosome core particle treated with cisplatin
3B6G 2007-12-25 3.45 Nucleosome core particle treated with oxaliplatin
6IY2 2019-04-03 3.47 Structure of Snf2-MMTV-A nucleosome complex at shl2 in ADP state
3AZH 2011-09-21 3.49 Crystal Structure of Human Nucleosome Core Particle Containing H3K122Q mutation
6SE6 2019-08-14 3.5 Class2 : CENP-A nucleosome in complex with CENP-C central region
4X23 2014-12-10 3.5 CRYSTAL STRUCTURE OF CENP-C IN COMPLEX WITH THE NUCLEOSOME CORE PARTICLE
6R94 2019-06-12 3.5 Cryo-EM structure of NCP_THF2(-3)
5C3I 2015-07-29 3.5 Crystal structure of the quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2
4QLC 2015-07-22 3.5 Crystal structure of chromatosome at 3.5 angstrom resolution
3KWQ 2010-05-12 3.5 Structural characterization of H3K56Q nucleosomes and nucleosomal arrays
5ZBA 2018-07-25 3.5 Crystal structure of Rtt109-Asf1-H3-H4-CoA complex
6O96 2019-04-24 3.5 Dot1L bound to the H2BK120 Ubiquitinated nucleosome
6MUP 2019-07-24 3.5 CENP-A nucleosome bound by two copies of CENP-C(CD) and two copies CENP-N(NT)
5KDM 2016-09-07 3.5 Crystal structure of EBV tegument protein BNRF1 in complex with histone chaperone DAXX and histones H3.3-H4
4YM6 2015-12-02 3.51 Crystal structure of the human nucleosome containing 6-4PP (outside)
6NQA 2019-02-20 3.54 Active state Dot1L bound to the H2B-Ubiquitinated nucleosome, 1-to-1 complex
6GEJ 2018-10-17 3.6 Chromatin remodeller-nucleosome complex at 3.6 A resolution.
5ZBB 2018-07-25 3.6 Crystal structure of Rtt109-Asf1-H3-H4 complex
6MUO 2019-07-24 3.6 CENP-A nucleosome bound by two copies of CENP-C(CD) and one copy CENP-N(NT)
6GEN 2018-10-17 3.6 Chromatin remodeller-nucleosome complex at 4.5 A resolution.
3AN2 2011-07-20 3.6 The structure of the centromeric nucleosome containing CENP-A
5B24 2016-03-02 3.6 The crystal structure of the nucleosome containing cyclobutane pyrimidine dimer
5Z3O 2019-04-03 3.62 Structure of Snf2-nucleosome complex in ADP state
6IY3 2019-04-03 3.67 Structure of Snf2-MMTV-A nucleosome complex at shl-2 in ADP state
6SEF 2019-08-14 3.7 Class2C : CENP-A nucleosome in complex with CENP-C central region
6ESF 2017-12-20 3.7 Nucleosome : Class 1
6IR9 2019-02-20 3.8 RNA polymerase II elongation complex bound with Elf1 and Spt4/5, stalled at SHL(-1) of the nucleosome
6SE0 2019-08-14 3.8 Class 1 : CENP-A nucleosome
6FQ5 2018-04-18 3.8 Class 1 : canonical nucleosome
4ZUX 2016-02-24 3.82 SAGA DUB module Ubp8/Sgf11/Sus1/Sgf73 bound to ubiqitinated nucleosome
6K1P 2019-05-29 3.87 The complex of ISWI-nucleosome in the ADP.BeF-bound state
6NE3 2019-07-17 3.9 Cryo-EM structure of singly-bound SNF2h-nucleosome complex with SNF2h bound at SHL-2
6NN6 2019-02-13 3.9 Structure of Dot1L-H2BK120ub nucleosome complex
6NOG 2019-02-20 3.9 Poised-state Dot1L bound to the H2B-Ubiquitinated nucleosome
6R8Z 2019-06-12 3.9 Cryo-EM structure of NCP_THF2(-1)-UV-DDB
6BUZ 2017-12-20 3.92 Cryo-EM structure of CENP-A nucleosome in complex with kinetochore protein CENP-N
5X0X 2017-04-19 3.97 Complex of Snf2-Nucleosome complex with Snf2 bound to position +6 of the nucleosome
6R93 2019-06-12 4.0 Cryo-EM structure of NCP-6-4PP
6FQ6 2018-04-18 4.0 Class 2 : distorted nucleosome
6C0W 2018-01-17 4.0 Cryo-EM structure of human kinetochore protein CENP-N with the centromeric nucleosome containing CENP-A
4YM5 2015-12-02 4.01 Crystal structure of the human nucleosome containing 6-4PP (inside)
6R1T 2019-04-24 4.02 Structure of LSD2/NPAC-linker/nucleosome core particle complex: Class 1, free nuclesome
5Z3T 2019-04-03 4.06 Structure of Snf2-nucleosome complex in ADP BeFx state
6R91 2019-06-12 4.1 Cryo-EM structure of NCP_THF2(-3)-UV-DDB
6J4Z 2019-02-20 4.1 RNA polymerase II elongation complex bound with Spt4/5 and foreign DNA, stalled at SHL(-1) of the nucleosome
6J99 2019-02-27 4.1 Cryo-EM structure of human DOT1L in complex with an H2B-monoubiquitinated nucleosome
6J51 2019-02-20 4.2 RNA polymerase II elongation complex bound with Spt4/5 and foreign DNA, stalled at SHL(-1) of the nucleosome, weak Elf1 (+1 position)
6SEE 2019-08-14 4.2 Class2A : CENP-A nucleosome in complex with CENP-C central region
5Z3V 2019-05-22 4.22 Structure of Snf2-nucleosome complex at shl-2 in ADP BeFx state
6J4Y 2019-02-20 4.3 RNA polymerase II elongation complex bound with Elf1 and Spt4/5, stalled at SHL(-1) of the nucleosome (+1B)
6R8Y 2019-06-12 4.3 Cryo-EM structure of NCP-6-4PP(-1)-UV-DDB
6J4X 2019-02-20 4.3 RNA polymerase II elongation complex bound with Elf1 and Spt4/5, stalled at SHL(-1) of the nucleosome (+1A)
5Z3L 2019-04-03 4.31 Structure of Snf2-nucleosome complex in apo state
5Z3U 2019-05-22 4.31 Structure of Snf2-nucleosome complex at shl2 in ADP BeFx state
6FML 2018-04-25 4.34 CryoEM Structure INO80core Nucleosome complex
6R1U 2019-04-24 4.36 Structure of LSD2/NPAC-linker/nucleosome core particle complex: Class 2
6I84 2019-01-02 4.4 Structure of transcribing RNA polymerase II-nucleosome complex
6R90 2019-06-12 4.5 Cryo-EM structure of NCP-THF2(+1)-UV-DDB class A
6FTX 2018-08-08 4.5 Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome
5HQ2 2016-03-23 4.5 Structural model of Set8 histone H4 Lys20 methyltransferase bound to nucleosome core particle
5KGF 2016-07-27 4.54 Structural model of 53BP1 bound to a ubiquitylated and methylated nucleosome, at 4.5 A resolution
6R25 2019-04-24 4.61 Structure of LSD2/NPAC-linker/nucleosome core particle complex: Class 3
5BSA 2015-07-08 4.61 Structure of histone H3/H4 in complex with Spt2
5X0Y 2017-04-19 4.69 Complex of Snf2-Nucleosome complex with Snf2 bound to SHL2 of the nucleosome
6J50 2019-02-20 4.7 RNA polymerase II elongation complex bound with Spt4/5 and foreign DNA, stalled at SHL(-1) of the nucleosome (tilted conformation)
5O9G 2017-10-11 4.8 Structure of nucleosome-Chd1 complex
6FQ8 2018-04-18 4.8 Class 3 : translocated nucleosome
6HTS 2018-11-07 4.8 Cryo-EM structure of the human INO80 complex bound to nucleosome
6R92 2019-06-12 4.8 Cryo-EM structure of NCP-THF2(+1)-UV-DDB class B
6ESH 2017-12-20 5.1 Nucleosome breathing : Class 3
5NL0 2017-05-17 5.4 Crystal structure of a 197-bp palindromic 601L nucleosome in complex with linker histone H1
6ESG 2017-12-20 5.4 Nucleosome breathing : Class 2
5WCU 2018-10-31 5.53 Crystal structure of 167 bp nucleosome bound to the globular domain of linker histone H5
6A5L 2018-10-03 5.6 RNA polymerase II elongation complex stalled at SHL(-1) of the nucleosome, with foreign DNA
5OY7 2017-09-20 5.77 Structure of the 4_601_157 tetranucleosome (P1 form)
6ESI 2017-12-20 6.3 Nucleosome breathing : Class 4
5G2E 2016-08-03 6.7 Structure of the Nap1 H2A H2B complex
6A5T 2018-10-03 6.7 RNA polymerase II elongation complex stalled at SHL(-1) of the nucleosome
5OXV 2017-10-11 6.72 Structure of the 4_601_157 tetranucleosome (C2 form)
6JMA 2019-05-15 6.8 cryo-EM structure of DOT1L bound to H2B ubiquitinated nucleosome
6INQ 2019-04-03 6.9 RNA polymerase II elongation complex stalled at SHL(-1) of the nucleosome, with foreign DNA (+1 position)
6A5P 2018-10-03 7.0 RNA polymerase II elongation complex stalled at SHL(-5) of the nucleosome
6JM9 2019-05-15 7.3 cryo-EM structure of DOT1L bound to unmodified nucleosome
6A5U 2018-10-03 7.6 RNA polymerase II elongation complex stalled at SHL(-1) of the nucleosome, with foreign DNA, tilt conformation
6J4W 2019-02-20 7.9 RNA polymerase II elongation complex bound with Elf1 and Spt4/5, stalled at SHL(-5) of the nucleosome
6A5R 2018-10-03 8.7 RNA polymerase II elongation complex stalled at SHL(-2) of the nucleosome
1ZBB 2005-07-12 9.0 Structure of the 4_601_167 Tetranucleosome
6HKT 2018-10-31 9.7 Structure of an H1-bound 6-nucleosome array
6A5O 2018-10-03 9.9 RNA polymerase II elongation complex stalled at SHL(-6) of the nucleosome

Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
91.4 Histone H2B 1/2/3/4/6 Q6DRA6 H2B2D_HUMAN
91.4 Histone H2B 1/2/3/4/6 Q6DN03 H2B2C_HUMAN
92.9 Histone H2B 1/2/3/4/6 Q7M4G7 H2B_PATPE
95.3 Histone H2B 1/2/3/4/6 P30757 H2B_SIPNU
95.4 Histone H2B 1/2/3/4/6 P02284 H2B_PATGR
96.6 Histone H2B 1/2/3/4/6 Q76FF3 H2B_DROTE
96.6 Histone H2B 1/2/3/4/6 P59782 H2B_DROSI
96.6 Histone H2B 1/2/3/4/6 Q76FE9 H2B_DROOR
96.6 Histone H2B 1/2/3/4/6 P02283 H2B_DROME
96.6 Histone H2B 1/2/3/4/6 Q76FE5 H2B_DROMA
96.6 Histone H2B 1/2/3/4/6 P59781 H2B_DROER
91.0 Histone H2B 1/2/3/4/6 P07794 H2BL1_PSAMI
93.3 Histone H2B 1/2/3/4/6 P21897 H2B_CHITH
94.4 Histone H2B 1/2/3/4/6 P27326 H2B_URECA
95.5 Histone H2B 1/2/3/4/6 Q8I1N0 H2B_DROYA
95.5 Histone H2B 1/2/3/4/6 Q76FD7 H2B_DROSE
95.5 Histone H2B 1/2/3/4/6 P17271 H2B_DROHY
95.5 Histone H2B 1/2/3/4/6 Q27442 H2B_ANOGA
95.5 Histone H2B 1/2/3/4/6 P35069 H2B3_TIGCA
95.5 Histone H2B 1/2/3/4/6 P35068 H2B1_TIGCA
96.6 Histone H2B 1/2/3/4/6 P19374 H2B_PLADU
96.6 Histone H2B 1/2/3/4/6 P83863 H2B_PENVA
94.4 Histone H2B 1/2/3/4/6 Q75VN4 H2B_RHASC
96.0 Histone H2B 1/2/3/4/6 Q64524 H2B2E_MOUSE
97.6 Histone H2B 1/2/3/4/6 Q99880 H2B1L_HUMAN
96.0 Histone H2B 1/2/3/4/6 Q8CGP2 H2B1P_MOUSE
92.2 B Histone H2A-IV P02281 H2B11_XENLA
97.6 Histone H2B 1/2/3/4/6 Q32L48 H2B1N_BOVIN
97.6 Histone H2B 1/2/3/4/6 Q8CGP1 H2B1K_MOUSE
97.6 Histone H2B 1/2/3/4/6 Q64475 H2B1B_MOUSE
96.8 Histone H2B 1/2/3/4/6 P57053 H2BFS_HUMAN
96.0 Histone H2B 1/2/3/4/6 Q99879 H2B1M_HUMAN
97.6 Histone H2B 1/2/3/4/6 Q2PFX4 H2B1K_MACFA
93.3 B Histone H2A-IV P06900 H2B12_XENLA
98.4 Histone H2B 1/2/3/4/6 P10853 H2B1F_MOUSE
99.2 Histone H2B 1/2/3/4/6 P14001 H2B_CAIMO
98.4 Histone H2B 1/2/3/4/6 P10854 H2B1M_MOUSE
98.4 Histone H2B 1/2/3/4/6 P58876 H2B1D_HUMAN
98.4 Histone H2B 1/2/3/4/6 Q99877 H2B1N_HUMAN
98.4 Histone H2B 1/2/3/4/6 O60814 H2B1K_HUMAN
98.4 Histone H2B 1/2/3/4/6 Q93079 H2B1H_HUMAN
99.2 Histone H2B 1/2/3/4/6 P23527 H2B1O_HUMAN
99.2 Histone H2B 1/2/3/4/6 P06899 H2B1J_HUMAN
96.7 B Histone H2A-IV P33778 H2B1B_HUMAN
99.2 Histone H2B 1/2/3/4/6 Q5R893 H2B1_PONAB
99.2 Histone H2B 1/2/3/4/6 P62808 H2B1_BOVIN
99.2 Histone H2B 1/2/3/4/6 Q64478 H2B1H_MOUSE
99.2 Histone H2B 1/2/3/4/6 Q6ZWY9 H2B1C_MOUSE
99.2 Histone H2B 1/2/3/4/6 P62807 H2B1C_HUMAN
96.8 Histone H2B 1/2/3/4/6 P0C1H4 H2B5_CHICK
100.0 Histone H2B 1/2/3/4/6 Q16778 H2B2E_HUMAN
100.0 Histone H2B 1/2/3/4/6 P0C1H3 H2B1_CHICK
92.0 D Histone H2A-IV P62791 H4_STYLE
92.0 D Histone H2A-IV P62790 H4_STENO
90.8 D Histone H2A-IV P02309 H4_YEAST
90.8 D Histone H2A-IV Q75AX1 H42_ASHGO
90.8 D Histone H2A-IV Q757K0 H41_ASHGO
92.1 D Histone H2A-IV Q8NIG3 H4_CANGA
92.1 D Histone H2A-IV Q8J1L3 H4_BLAAD
92.0 D Histone H2A-IV Q6ZXX3 H4_USTMA
92.1 D Histone H2A-IV Q8NIQ8 H42_TALFU
92.1 D Histone H2A-IV P23751 H42_EMENI
92.1 D Histone H2A-IV P04914 H4_NEUCR
92.1 D Histone H2A-IV Q76MU7 H4_ASPOR
92.1 D Histone H2A-IV Q7LKT3 H4_ASPFU
92.1 D Histone H2A-IV Q711M0 H41_TALFU
92.1 D Histone H2A-IV P23750 H41_EMENI
94.7 D Histone H2A-IV P08436 H4_VOLCA
96.1 D Histone H2A-IV P91890 H4_TRICD
90.8 D Histone H2A-IV Q8T7J8 H4_EIMTE
96.1 D Histone H2A-IV P83865 H4_PENVA
94.7 D Histone H2A-IV P04915 H4_PHYPO
94.7 D Histone H2A-IV P50566 H4_CHLRE
94.7 D Histone H2A-IV P62792 H4_PHACH
96.1 D Histone H2A-IV Q27443 H4_ASCSU
94.7 D Histone H2A-IV P62793 H4_AGABI
96.1 D Histone H2A-IV Q9HDF5 H4_MORAP
97.4 D Histone H2A-IV P91849 H4_APIME
96.1 D Histone H2A-IV Q41811 H43_MAIZE
97.4 D Histone H2A-IV P27996 H4_SOLST
97.4 D Histone H2A-IV Q43083 H4_PYRSA
97.4 D Histone H2A-IV P91882 H4_DIAPU
98.7 D Histone H2A-IV Q8MTV8 H4_APLCA
98.7 D Histone H2A-IV P70081 H48_CHICK
96.1 D Histone H2A-IV P35057 H4_SOLLC
96.1 D Histone H2A-IV Q6V9I2 H4_SOLCH
96.1 D Histone H2A-IV Q71V09 H4_CAPAN
98.7 D Histone H2A-IV P62783 H4_STRPU
98.7 D Histone H2A-IV P62779 H4_PYCHE
98.7 D Histone H2A-IV P62781 H4_PSAMI
98.7 D Histone H2A-IV P62778 H4_PISOC
98.7 D Histone H2A-IV P62777 H4_PISBR
98.7 D Histone H2A-IV P62780 H4_PARLI
97.4 D Histone H2A-IV Q9U7D0 H4_MASBA
98.7 D Histone H2A-IV P62782 H4_LYTPI
98.7 D Histone H2A-IV P62776 H4_HOLTU
98.7 D Histone H2A-IV P62784 H4_CAEEL
97.4 D Histone H2A-IV P0CG89 H4_SOYBN
97.4 D Histone H2A-IV Q76H85 H4_SILLA
97.4 D Histone H2A-IV P62788 H4_PEA
97.4 D Histone H2A-IV P62787 H4_MAIZE
97.4 D Histone H2A-IV P62887 H4_LOLTE
97.4 D Histone H2A-IV Q6LAF3 H4_FLATR
97.4 D Histone H2A-IV Q6WZ83 H4_EUCGL
97.4 D Histone H2A-IV Q6PMI5 H4_CHEMJ
97.4 D Histone H2A-IV P59259 H4_ARATH
97.4 D Histone H2A-IV P62786 H42_WHEAT
97.4 D Histone H2A-IV P62785 H41_WHEAT
98.7 D Histone H2A-IV Q27765 H4_STYPL
98.7 D Histone H2A-IV P82888 H4_OLILU
98.7 D Histone H2A-IV Q8I0Y4 H4_OIKDI
100.0 D Histone H2A-IV Q28DR4 H4_XENTR
100.0 D Histone H2A-IV P62799 H4_XENLA
100.0 D Histone H2A-IV P62798 H4_XENBO
100.0 D Histone H2A-IV P62794 H4_URECA
100.0 D Histone H2A-IV P84045 H4_TIGCA
100.0 D Histone H2A-IV P84050 H4_RHYAM
100.0 D Histone H2A-IV P62804 H4_RAT
100.0 D Histone H2A-IV Q5RCS7 H4_PONAB
100.0 D Histone H2A-IV P62795 H4_PLADU
100.0 D Histone H2A-IV P62802 H4_PIG
100.0 D Histone H2A-IV P62796 H4_ORENI
100.0 D Histone H2A-IV P62797 H4_ONCMY
100.0 D Histone H2A-IV Q6WV72 H4_MYTTR
100.0 D Histone H2A-IV Q6WV90 H4_MYTGA
100.0 D Histone H2A-IV Q7K8C0 H4_MYTED
100.0 D Histone H2A-IV Q6WV74 H4_MYTCH
100.0 D Histone H2A-IV Q6WV73 H4_MYTCA
100.0 D Histone H2A-IV P84049 H4_MYRRU
100.0 D Histone H2A-IV P62806 H4_MOUSE
100.0 D Histone H2A-IV Q4R362 H4_MACFA
100.0 D Histone H2A-IV P62805 H4_HUMAN
100.0 D Histone H2A-IV P84044 H4_DROYA
100.0 D Histone H2A-IV Q76FF5 H4_DROTE
100.0 D Histone H2A-IV P84043 H4_DROSI
100.0 D Histone H2A-IV Q76FD9 H4_DROSE
100.0 D Histone H2A-IV Q76FF1 H4_DROOR
100.0 D Histone H2A-IV P84040 H4_DROME
100.0 D Histone H2A-IV Q76FE7 H4_DROMA
100.0 D Histone H2A-IV P84042 H4_DROHY
100.0 D Histone H2A-IV P84041 H4_DROER
100.0 D Histone H2A-IV Q6LAF1 H4_DENKL
100.0 D Histone H2A-IV P84046 H4_CHITH
100.0 D Histone H2A-IV P62801 H4_CHICK
100.0 D Histone H2A-IV Q7KQD1 H4_CHAVR
100.0 D Histone H2A-IV P62800 H4_CAIMO
100.0 D Histone H2A-IV P62803 H4_BOVIN
100.0 D Histone H2A-IV P84047 H4_ASEAQ
100.0 D Histone H2A-IV P35059 H4_ACRFO
100.0 D Histone H2A-IV P84048 H4_ACRAS
96.8 B Histone H2A-IV P02280 H2B_CRONI
93.3 B Histone H2A-IV Q00715 H2B1_RAT
92.2 B Histone H2A-IV P70696 H2B1A_MOUSE
93.3 B Histone H2A-IV Q00729 H2B1A_RAT
94.4 B Histone H2A-IV Q8CGP0 H2B3B_MOUSE
94.4 B Histone H2A-IV Q8N257 H2B3B_HUMAN
94.4 B Histone H2A-IV Q9D2U9 H2B3A_MOUSE
94.4 B Histone H2A-IV P69070 H2B_SALTR
94.4 B Histone H2A-IV P69069 H2B_ONCMY
95.6 B Histone H2A-IV P0C1H5 H2B7_CHICK
94.4 B Histone H2A-IV Q2M2T1 H2B1K_BOVIN
95.6 B Histone H2A-IV Q6PC60 H2B3_DANRE
95.6 B Histone H2A-IV Q5BJA5 H2B1_DANRE
95.6 B Histone H2A-IV Q5QNW6 H2B2F_HUMAN
95.6 B Histone H2A-IV Q64525 H2B2B_MOUSE
96.7 B Histone H2A-IV Q9PSW9 H2B8_CHICK
96.7 B Histone H2A-IV Q5RCP8 H2B2E_PONAB
92.4 C Histone H2A-IV P81196 H39_STYLE
92.4 C Histone H2A-IV P81201 H37_STYLE
91.1 C Histone H2A-IV P81199 H35_STYLE
93.7 C Histone H2A-IV P81197 H33_STYLE
95.0 C Histone H2A-IV P06353 H33_HORVU
90.1 C Histone H2A-IV Q6C0C4 H3_YARLI
90.3 C Histone H2A-IV Q4P7J7 H31_USTMA
92.4 C Histone H2A-IV Q9HDN1 H3_MORAP
90.3 C Histone H2A-IV A5DWE2 H31_LODEL
90.3 C Histone H2A-IV P0CO04 H3_CRYNJ
90.3 C Histone H2A-IV P0CO05 H3_CRYNB
92.4 C Histone H2A-IV Q4PB04 H32_USTMA
90.3 C Histone H2A-IV Q55BN9 H33B_DICDI
91.4 C Histone H2A-IV Q9FXI7 H3L2_ARATH
91.4 C Histone H2A-IV P90543 H3_EUPCR
91.4 C Histone H2A-IV Q9FX60 H3L1_ARATH
91.4 C Histone H2A-IV O15819 H33A_DICDI
93.5 C Histone H2A-IV P06902 H3C_CAIMO
91.4 C Histone H2A-IV Q402E2 H33A_LILLO
93.5 C Histone H2A-IV P50564 H33_CHLRE
91.4 C Histone H2A-IV Q2Z2F4 H33B_LILLO
94.6 C Histone H2A-IV Q6NXT2 H3C_HUMAN
92.4 C Histone H2A-IV Q7XYZ0 H3_GRIJA
92.5 C Histone H2A-IV Q9FKQ3 H3L5_ARATH
92.5 C Histone H2A-IV A5PK61 H3C_BOVIN
92.5 C Histone H2A-IV Q27532 H33L2_CAEEL
92.5 C Histone H2A-IV Q9LR02 H3L3_ARATH
94.6 C Histone H2A-IV Q402E1 H32_LILLO
94.6 C Histone H2A-IV Q5RCC9 H33_PONAB
93.5 C Histone H2A-IV Q42681 H31_CHLRE
94.6 C Histone H2A-IV Q8WSF1 H33_TRIPS
94.6 C Histone H2A-IV Q9U281 H332_CAEEL
94.6 C Histone H2A-IV Q16695 H31T_HUMAN
94.6 C Histone H2A-IV Q71H73 H33_VITVI
94.6 C Histone H2A-IV Q76N23 H33_TOBAC
94.6 C Histone H2A-IV Q711T2 H33_PINPS
94.6 C Histone H2A-IV Q0JCT1 H33_ORYSJ
94.6 C Histone H2A-IV A2XHJ3 H33_ORYSI
94.6 C Histone H2A-IV Q71U98 H33_ORYCO
94.6 C Histone H2A-IV P69244 H33_MEDSA
94.6 C Histone H2A-IV P69245 H33_LOLTE
94.6 C Histone H2A-IV Q3C2E5 H33_LOLMU
94.6 C Histone H2A-IV Q71V89 H33_GOSHI
94.6 C Histone H2A-IV Q6RUR1 H33_CAPAN
94.6 C Histone H2A-IV P59169 H33_ARATH
94.6 C Histone H2A-IV P08437 H3_VOLCA
94.6 C Histone H2A-IV Q9U7D1 H3_MASBA
95.7 C Histone H2A-IV P08898 H3_CAEEL
94.6 C Histone H2A-IV Q6LCW8 H32_CHLRE
96.8 C Histone H2A-IV P06352 H3_STRPU
95.7 C Histone H2A-IV P02301 H3C_MOUSE
95.7 C Histone H2A-IV Q6P823 H33_XENTR
95.7 C Histone H2A-IV Q6PI79 H33_XENLA
95.7 C Histone H2A-IV P84248 H33_SPISO
95.7 C Histone H2A-IV P84245 H33_RAT
95.7 C Histone H2A-IV P84246 H33_RABIT
95.7 C Histone H2A-IV Q71LE2 H33_PIG
95.7 C Histone H2A-IV P84244 H33_MOUSE
95.7 C Histone H2A-IV P84243 H33_HUMAN
95.7 C Histone H2A-IV P84250 H33_DROHY
95.7 C Histone H2A-IV Q6PI20 H33_DANRE
95.7 C Histone H2A-IV P84247 H33_CHICK
95.7 C Histone H2A-IV Q5E9F8 H33_BOVIN
95.7 C Histone H2A-IV C0HL67 H33B_DROME
95.7 C Histone H2A-IV C0HL66 H33A_DROME
95.7 C Histone H2A-IV Q10453 H331_CAEEL
95.7 C Histone H2A-IV P68428 H32_WHEAT
95.7 C Histone H2A-IV Q76MV0 H32_TOBAC
95.7 C Histone H2A-IV P69248 H32_PETCR
95.7 C Histone H2A-IV P68427 H32_PEA
95.7 C Histone H2A-IV Q2RAD9 H32_ORYSJ
95.7 C Histone H2A-IV A2Y533 H32_ORYSI
95.7 C Histone H2A-IV P68430 H32_ONOVI
95.7 C Histone H2A-IV P68429 H32_MEDSA
95.7 C Histone H2A-IV P69246 H32_MAIZE
95.7 C Histone H2A-IV Q71T45 H32_EUPES
95.7 C Histone H2A-IV Q5MYA4 H32_CICIN
95.7 C Histone H2A-IV Q6LCK1 H32_BRANA
95.7 C Histone H2A-IV Q6LBE3 H32_ASPOF
95.7 C Histone H2A-IV P59226 H32_ARATH
96.8 C Histone H2A-IV P02302 H3C_XENLA
96.8 C Histone H2A-IV P08903 H32_ENCAL
97.8 C Histone H2A-IV Q6LED0 H31_RAT
97.8 C Histone H2A-IV Q6LBF0 H31_MUSPA
97.8 C Histone H2A-IV P68433 H31_MOUSE
97.8 C Histone H2A-IV P68431 H31_HUMAN
97.8 C Histone H2A-IV P68432 H31_BOVIN
97.8 C Histone H2A-IV P69079 H3_STRDR
97.8 C Histone H2A-IV P69078 H3_SOLST
97.8 C Histone H2A-IV P69077 H3_PYCHE
97.8 C Histone H2A-IV P69076 H3_PSAMI
97.8 C Histone H2A-IV P69075 H3_PISOC
97.8 C Histone H2A-IV P69074 H3_PISBR
97.8 C Histone H2A-IV P69073 H3_PARLI
97.8 C Histone H2A-IV P69072 H3_LYTPI
97.8 C Histone H2A-IV P69071 H3_DERIM
97.8 C Histone H2A-IV Q64400 H32_CRILO
97.8 C Histone H2A-IV P22843 H3_ACRFO
98.9 C Histone H2A-IV P84239 H3_URECA
98.9 C Histone H2A-IV P84237 H3_TIGCA
98.9 C Histone H2A-IV P84235 H3_PLADU
98.9 C Histone H2A-IV P02299 H3_DROME
98.9 C Histone H2A-IV P84236 H3_DROHY
98.9 C Histone H2A-IV P84238 H3_CHITH
98.9 C Histone H2A-IV Q28D37 H32_XENTR
98.9 C Histone H2A-IV P84233 H32_XENLA
98.9 C Histone H2A-IV P84232 H32_PORAF
98.9 C Histone H2A-IV P84234 H32_ONCMY
98.9 C Histone H2A-IV Q6LBE8 H32_MUSPA
98.9 C Histone H2A-IV P84228 H32_MOUSE
98.9 C Histone H2A-IV P84231 H32_ICTBU
98.9 C Histone H2A-IV Q71DI3 H32_HUMAN
98.9 C Histone H2A-IV Q4QRF4 H32_DANRE
98.9 C Histone H2A-IV P84229 H32_CHICK
98.9 C Histone H2A-IV P84230 H32_CAIMO
98.9 C Histone H2A-IV P84227 H32_BOVIN
96.0 A Histone H2A-IV P55897 H2A_BUFGR
94.6 A Histone H2A-IV P59890 H2A_HIPHI
95.1 A Histone H2A-IV P09590 H2A3_STRPU
93.2 A Histone H2A-IV P16886 H2AL_STRPU
92.2 A Histone H2A-IV Q6WV67 H2A_MYTTR
92.2 A Histone H2A-IV P04736 H2A2_PSAMI
93.4 A Histone H2A-IV P02269 H2A_ASTRU
94.4 A Histone H2A-IV Q1E5N1 H2A_COCIM
91.2 A Histone H2A-IV Q4PEF9 H2A_USTMA
93.3 A Histone H2A-IV Q6WV88 H2A_MYTGA
93.3 A Histone H2A-IV Q8I0T3 H2A_MYTED
93.3 A Histone H2A-IV Q6WV69 H2A_MYTCH
93.3 A Histone H2A-IV Q6WV66 H2A_MYTCA
94.4 A Histone H2A-IV P07793 H2A4_PSAMI
92.3 A Histone H2A-IV P27325 H2A_URECA
92.3 A Histone H2A-IV P02270 H2A_SIPNU
95.6 A Histone H2A-IV P69140 H2A_PARAN
95.6 A Histone H2A-IV P69139 H2A3_PSAMI
92.5 A Histone H2A-IV Q07135 H2AO_CHITH
94.6 A Histone H2A-IV Q0U1A1 H2A_PHANO
92.5 A Histone H2A-IV P21896 H2A_CHITH
90.5 A Histone H2A-IV P09588 H2A_CAEEL
91.6 A Histone H2A-IV P04910 H2A2_SCHPO
91.6 A Histone H2A-IV P04909 H2A1_SCHPO
90.5 A Histone H2A-IV P02268 H2A_SEPOF
91.6 A Histone H2A-IV P04735 H2A1_PSAMI
93.7 A Histone H2A-IV P09589 H2A3_LYTPI
91.6 A Histone H2A-IV P69141 H2A_STRPU
91.6 A Histone H2A-IV P69142 H2AE_PSAMI
93.7 A Histone H2A-IV Q875B8 H2A_PODAS
93.7 A Histone H2A-IV Q8X132 H2A_NEUCR
93.7 A Histone H2A-IV A1D8G8 H2A_NEOFI
93.7 A Histone H2A-IV L7HZV6 H2A_MAGOY
93.7 A Histone H2A-IV P0CT12 H2A_MAGO7
93.7 A Histone H2A-IV Q4HTT1 H2A_GIBZE
93.7 A Histone H2A-IV P08844 H2A_EMENI
93.7 A Histone H2A-IV Q2HH37 H2A_CHAGB
93.7 A Histone H2A-IV O74268 H2A_BOTFB
93.7 A Histone H2A-IV Q0CBD2 H2A_ASPTN
93.7 A Histone H2A-IV Q2U5A8 H2A_ASPOR
93.7 A Histone H2A-IV P0C952 H2A_ASPNG
93.7 A Histone H2A-IV P0C953 H2A_ASPNC
93.7 A Histone H2A-IV Q4WWC6 H2A_ASPFU
93.7 A Histone H2A-IV A1CJ10 H2A_ASPCL
92.6 A Histone H2A-IV P13630 H2A_PARLI
92.6 A Histone H2A-IV P84057 H2A_TIGCA
92.6 A Histone H2A-IV P84056 H2A_RHYAM
92.6 A Histone H2A-IV P19178 H2A_PLADU
92.6 A Histone H2A-IV P84055 H2A_DROYA
92.6 A Histone H2A-IV P84054 H2A_DROSI
92.6 A Histone H2A-IV P84051 H2A_DROME
92.6 A Histone H2A-IV P84053 H2A_DROHY
92.6 A Histone H2A-IV P84052 H2A_DROER
92.6 A Histone H2A-IV P35061 H2A_ACRFO
92.6 A Histone H2A-IV Q6PV61 H2A_PENVA
94.7 A Histone H2A-IV Q6GM86 H2AX_XENLA
94.7 A Histone H2A-IV Q00728 H2A4_RAT
95.8 A Histone H2A-IV Q64598 H2A1F_RAT
97.9 A Histone H2A-IV P27661 H2AX_MOUSE
97.9 A Histone H2A-IV P16104 H2AX_HUMAN
95.8 A Histone H2A-IV Q96QV6 H2A1A_HUMAN
96.8 A Histone H2A-IV P02264 H2A_ONCMY
96.8 A Histone H2A-IV Q7ZUY3 H2AX_DANRE
96.8 A Histone H2A-IV P06897 H2A1_XENLA
96.8 A Histone H2A-IV Q64522 H2A2B_MOUSE
96.8 A Histone H2A-IV C0HKE9 H2A1P_MOUSE
96.8 A Histone H2A-IV C0HKE8 H2A1O_MOUSE
96.8 A Histone H2A-IV C0HKE7 H2A1N_MOUSE
96.8 A Histone H2A-IV Q8CGP7 H2A1K_MOUSE
96.8 A Histone H2A-IV C0HKE6 H2A1I_MOUSE
96.8 A Histone H2A-IV Q8CGP6 H2A1H_MOUSE
96.8 A Histone H2A-IV C0HKE5 H2A1G_MOUSE
96.8 A Histone H2A-IV Q8CGP5 H2A1F_MOUSE
96.8 A Histone H2A-IV C0HKE4 H2A1E_MOUSE
96.8 A Histone H2A-IV C0HKE3 H2A1D_MOUSE
96.8 A Histone H2A-IV C0HKE2 H2A1C_MOUSE
96.8 A Histone H2A-IV C0HKE1 H2A1B_MOUSE
96.8 A Histone H2A-IV P04908 H2A1B_HUMAN
97.9 A Histone H2A-IV Q8IUE6 H2A2B_HUMAN
97.9 A Histone H2A-IV Q4FZT6 H2A3_RAT
97.9 A Histone H2A-IV Q8BFU2 H2A3_MOUSE
97.9 A Histone H2A-IV Q7L7L0 H2A3_HUMAN
97.9 A Histone H2A-IV P0C170 H2A1E_RAT
97.9 A Histone H2A-IV P20671 H2A1D_HUMAN
98.9 A Histone H2A-IV P35062 H2A3_CHICK
98.9 A Histone H2A-IV A9UMV8 H2AJ_RAT
98.9 A Histone H2A-IV Q8R1M2 H2AJ_MOUSE
98.9 A Histone H2A-IV P0C0S8 H2A1_HUMAN
98.9 A Histone H2A-IV P0C0S9 H2A1_BOVIN
98.9 A Histone H2A-IV Q99878 H2A1J_HUMAN
98.9 A Histone H2A-IV Q96KK5 H2A1H_HUMAN
98.9 A Histone H2A-IV P0C169 H2A1C_RAT
98.9 A Histone H2A-IV Q93077 H2A1C_HUMAN
98.9 A Histone H2A-IV P70082 H2AJ_CHICK
98.9 A Histone H2A-IV Q64523 H2A2C_MOUSE
98.9 A Histone H2A-IV Q16777 H2A2C_HUMAN
98.9 A Histone H2A-IV A1A4R1 H2A2C_BOVIN
98.9 A Histone H2A-IV P0CC09 H2A2A_RAT
98.9 A Histone H2A-IV Q6GSS7 H2A2A_MOUSE
98.9 A Histone H2A-IV Q6FI13 H2A2A_HUMAN
100.0 A Histone H2A-IV P13912 H2A_CAIMO
100.0 A Histone H2A-IV Q4R3X5 H2AJ_MACFA
100.0 A Histone H2A-IV Q9BTM1 H2AJ_HUMAN
100.0 A Histone H2A-IV Q3ZBX9 H2AJ_BOVIN
100.0 A Histone H2A-IV P02263 H2A4_CHICK
100.0 A Histone H2A-IV P02262 H2A1_RAT