Contribution of the 30/36 hydrophobic contact at the C-terminus of the alpha-helix to the stability of the ubiquitin molecule.

Abstract

The contribution of the hydrophobic contact in the C-capping motif of the alpha-helix to the thermodynamic stability of the ubiquitin molecule has been analyzed. For this, 16 variants of ubiquitin containing the full combinatorial set of four nonpolar residues Val, Ile, Leu, and Phe at C4 (Ile30) and C' ' (Ile36) positions were generated. The secondary structure content as estimated using far-UV circular dichroism (CD) spectroscopy of all but Phe variants at position 30 did not show notable changes upon substitutions. The thermodynamic stability of these ubiquitin variants was measured using differential scanning calorimetry, and it was shown that all variants have lower stability as measured by decreases in the Gibbs energy. Since in some cases the decrease in stability was so dramatic that it rendered an unfolded protein, it was therefore concluded that, despite apparent preservation of the secondary structure, the 30/36 hydrophobic contact is essential for the stability of the ubiquitin molecule. The decrease in the Gibbs energy in many cases was found to be accompanied by a large (up to 25%) decrease in the enthalpy of unfolding, particularly significant in the variants containing Ile to Leu substitutions. This decrease in enthalpy of unfolding is proposed to be primarily the result of the perturbed packing interactions in the native state of the Ile --> Leu variants. The analysis of these data and comparison with effects of similar amino acid substitutions on the stability of other model systems suggest that Ile --> Leu substitutions cannot be isoenergetic at the buried site. Study holds ProTherm entries: 8105, 8106, 8107, 8108, 8109, 8110, 8111, 8112, 8113, 8114, 8115, 8116, 8117, 8118, 8119, 8120, 8121, 8122, 8123, 8124, 8125, 8126, 8127, 8128, 8129, 8130, 8131, 8132, 8133, 8134, 8135, 8136, 8137, 8138, 8139, 8140, 8141, 8142, 8143, 8144, 8145, 8146, 8147, 8148, 8149, 8150, 8151, 8152, 8153, 8154, 8155, 8156, 8157, 8158, 8159, 8160, 8161, 8162, 8163, 8164, 8165, 8166, 8167, 8168, 8169, 8170, 8171, 8172, 8173, 8174, 8175, 8176, 8177, 8178, 8179, 8180, 8181, 8182, 8183, 8184, 8185, 8186, 8187, 8188, 8189, 8190, 8191, 8192, 8193, 8194, 8195, 8196, 8197, 8198, 8199, 14426, 14427, 14428, 14429, 14430, 14431, 14432, 14433, 14434, 14435, 14436, 14437, 14438 Extra Details: hydrophobic contact; nonpolar residues; secondary structure content;,packing interactions

Submission Details

ID: uBteUt3S4

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:35 p.m.

Version: 1

Publication Details
Thomas ST;Makhatadze GI,Biochemistry (2000) Contribution of the 30/36 hydrophobic contact at the C-terminus of the alpha-helix to the stability of the ubiquitin molecule. PMID:10956017
Additional Information

Study Summary

Number of data points 295
Proteins E3 ubiquitin-protein ligase RSP5 ; Ubiquitin-binding protein CUE2
Unique complexes 15
Assays/Quantities/Protocols Experimental Assay: dHcal temp:50.0 C, pH:3.0, ionic:-: -, prot_conc:1-50 mg/ml ; Experimental Assay: dCp temp:50.0 C, ionic:-: -, prot_conc:1-50 mg/ml ; Experimental Assay: dG ; Experimental Assay: dCp prot_conc:1,50 mg/ml, ionic:: ; Experimental Assay: dHcal buffers:Sodium acetate: 10 mM, pH:4.0, ionic:: , prot_conc:1,50 mg/ml ; Experimental Assay: Tm buffers:Sodium acetate: 10 mM, pH:4.0 ; Experimental Assay: dHcal pH:3.75, buffers:Sodium acetate: 10 mM, ionic:: , prot_conc:1,50 mg/ml ; Experimental Assay: Tm pH:3.75, buffers:Sodium acetate: 10 mM ; Experimental Assay: dHcal pH:2.25, prot_conc:1,50 mg/ml, ionic:: ; Experimental Assay: Tm pH:2.25, buffers:glycine-HCl: 10 mM ; Experimental Assay: dTm pH:2.5 ; Experimental Assay: dHcal buffers:Sodium acetate: 10 mM, prot_conc:1,50 mg/ml, ionic:: , pH:4.5 ; Experimental Assay: Tm buffers:Sodium acetate: 10 mM, pH:4.5 ; Experimental Assay: dTm pH:3.25 ; Experimental Assay: dTm pH:3.0 ; Experimental Assay: dHcal buffers:Sodium acetate: 10 mM, ionic:: , pH:3.5, prot_conc:1,50 mg/ml ; Experimental Assay: Tm buffers:Sodium acetate: 10 mM, pH:3.5 ; Experimental Assay: dHcal prot_conc:1,50 mg/ml, ionic:: , pH:3.25 ; Experimental Assay: Tm pH:3.25, buffers:glycine-HCl: 10 mM ; Experimental Assay: dHcal prot_conc:1,50 mg/ml, pH:3.0, ionic:: ; Experimental Assay: Tm pH:3.0, buffers:glycine-HCl: 10 mM ; Experimental Assay: dTm pH:2.75 ; Experimental Assay: dHcal prot_conc:1,50 mg/ml, ionic:: , pH:2.75 ; Experimental Assay: Tm pH:2.75, buffers:glycine-HCl: 10 mM ; Experimental Assay: dHcal prot_conc:1,50 mg/ml, pH:2.5, ionic:: ; Experimental Assay: Tm pH:2.5, buffers:glycine-HCl: 10 mM ; Experimental Assay: dHcal prot_conc:1,50 mg/ml, ionic:: , pH:2.0 ; Experimental Assay: Tm pH:2.0, buffers:glycine-HCl: 10 mM ; Derived Quantity: ddG ; Derived Quantity: dTm buffers:Sodium acetate: 10 mM, pH:3.5
Libraries Mutations for sequence A:NDDHESKLSILMDMFPAISKSKLQVHLLENNNDLDLTIGLLLKENDDKS/B:MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant PDB Entries

Structure ID Release Date Resolution Structure Title
2L0T 2010-12-15 Solution structure of the complex of ubiquitin and the VHS domain of Stam2
2G3Q 2006-05-09 Solution Structure of Ede1 UBA-ubiquitin complex
1C3T 1999-08-20 ROTAMER STRAIN AS A DETERMINANT OF PROTEIN STRUCTURAL SPECIFICITY
2N13 2016-03-09 Complex structure of MyUb (1080-1122) of human Myosin VI with K63-diUb
2N3W 2016-02-24 Solution structure of the Rpn1 T1 site with K48-linked diubiquitin in the contracted binding mode
1FXT 2001-10-10 STRUCTURE OF A CONJUGATING ENZYME-UBIQUITIN THIOLESTER COMPLEX
1UD7 1999-05-06 SOLUTION STRUCTURE OF THE DESIGNED HYDROPHOBIC CORE MUTANT OF UBIQUITIN, 1D7
2K25 2008-09-30 Automated NMR Structure of the UBB by FAPSY
2N3V 2016-02-24 Solution structure of the Rpn1 T1 site with K48-linked diubiquitin in the extended binding mode
2K8B 2009-05-05 Solution structure of PLAA family ubiquitin binding domain (PFUC) cis isomer in complex with ubiquitin
2NBE 2016-05-18 Solution structure of V26A mutant of Ubiquitin at pH 2.0
2MRO 2015-02-04 Structure of the complex of ubiquitin and the UBA domain from DNA-damage-inducible 1 protein (Ddi1)
2LJ5 2012-07-18 Description of the Structural fluctuations of proteins from structure-based calculations of Residual dipolar couplings
6KOX 2019-08-28 Relaxed state of S65/T66 double-phosphorylated ubiquitin
2NR2 2007-05-08 The MUMO (minimal under-restraining minimal over-restraining) method for the determination of native states ensembles of proteins
2KTF 2010-11-03 Solution NMR structure of human polymerase iota UBM2 in complex with ubiquitin
2KHW 2010-02-23 Solution Structure of the human Polymerase iota UBM2-Ubiquitin Complex
6QF8 2019-04-10 Solution NMR ensemble for human ubiquitin at 298K compiled using the CoMAND method
2PEA 2007-07-10 NMR Based Structure of the Closed Conformation of LYS48-Linked Di-Ubiquitin Using Experimental Global Rotational Diffusion Tensor from NMR Relaxation Measurements
1YX5 2005-04-19 Solution Structure of S5a UIM-1/Ubiquitin Complex
2N3U 2016-02-24 Solution structure of the Rpn1 T1 site engaging two monoubiquitin molecules
2KDI 2010-02-09 Solution structure of a Ubiquitin/UIM fusion protein
2KOX 2011-06-08 NMR residual dipolar couplings identify long range correlated motions in the backbone of the protein ubiquitin
2L3Z 2011-02-16 Proton-Detected 4D DREAM Solid-State NMR Structure of Ubiquitin
5UJN 2018-08-08 Representative 2-conformer ensembles of K27-linked Ub2 from RDC data
1GJZ 2001-12-13 Solution structure of a dimeric N-terminal fragment of human ubiquitin
2NBD 2016-05-18 Solution structure of V26A mutant of Ubiquitin at pH 6.0
2JRI 2008-07-01 Solution structure of the Josephin domain of Ataxin-3 in complex with ubiquitin molecule.
2KLG 2009-10-06 PERE NMR structure of ubiquitin
2FUH 2006-03-28 Solution Structure of the UbcH5c/Ub Non-covalent Complex
2MRE 2014-10-22 NMR structure of the Rad18-UBZ/ubiquitin complex
1YX6 2005-04-19 Solution Structure of S5a UIM-2/Ubiquitin Complex
1OTR 2003-06-24 Solution Structure of a CUE-Ubiquitin Complex
2JT4 2007-09-25 Solution Structure of the Sla1 SH3-3-Ubiquitin Complex
5XK5 2017-06-28 Relaxed state of S65-phosphorylated ubiquitin
6KOW 2019-08-28 Retracted state of S65/T66 double-phosphorylated ubiquitin
2LD9 2011-06-08 Backbone Structure of Ubiquitin determined using Backbone amide NOEs and Backbone N-H and N-C RDCs
1ZW7 2006-05-16 Elimination of the C-cap in Ubiquitin Structure, Dynamics and Thermodynamic Consequences
2KJH 2009-12-08 NMR based structural model of the UBCH8-UBIQUITIN complex
2RR9 2011-07-06 The solution structure of the K63-Ub2:tUIMs complex
6OQ2 2019-10-23 NMR Structure of Branched K11/K48-Linked Tri-Ubiquitin
1ZGU 2006-04-04 Solution structure of the human Mms2-Ubiquitin complex
2MBH 2013-10-09 NMR structure of EKLF(22-40)/Ubiquitin Complex
1Q5W 2004-03-30 Ubiquitin Recognition by Npl4 Zinc-Fingers
2DEN 2006-06-13 Solution Structure of the Ubiquitin-Associated Domain of Human BMSC-UbP and its Complex with Ubiquitin
2RSU 2013-03-27 Alternative structure of Ubiquitin
5VEY 2017-05-17 Solution NMR structure of histone H2A-H2B mono-ubiquitylated at H2A Lys15 in complex with RNF169 (653-708)
6N13 2018-11-28 UbcH7-Ub Complex with R0RBR Parkin and phosphoubiquitin
5XK4 2017-06-28 Retracted state of S65-phosphorylated ubiquitin
2MWS 2015-03-25 Structure of the complex of ubiquitin and the ubiquitin-like (UBL) domain of Ddi1
5ZD0 2019-08-21 Solution structure of human ubiquitin with three alanine mutations in living eukaryotic cells by in-cell NMR spectroscopy
2MI8 2014-04-02 Solution structure of lysine-free (K0) ubiquitin
2JZZ 2008-03-25 Solid-State NMR Structure of Microcrystalline Ubiquitin
2MOR 2014-06-25 A tensor-free method for the structural and dynamical refinement of proteins using residual dipolar couplings
2LVP 2012-11-21 gp78CUE domain bound to the distal ubiquitin of K48-linked diubiquitin
2KDE 2009-09-01 NMR structure of major S5a (196-306):K48 linked diubiquitin species
2K6D 2008-08-19 CIN85 Sh3-C domain in complex with ubiquitin
2JWZ 2008-01-08 Mutations in the hydrophobic core of ubiquitin differentially affect its recognition by receptor proteins
2K8C 2009-05-05 Solution structure of PLAA family ubiquitin binding domain (PFUC) trans isomer in complex with ubiquitin
2K39 2008-06-24 Recognition dynamics up to microseconds revealed from RDC derived ubiquitin ensemble in solution
1WR1 2005-04-19 The complex sturcture of Dsk2p UBA with ubiquitin
2PE9 2007-07-10 NMR Based Structure of the Open Conformation of LYS48-Linked Di-UBiquitin Using Experimental Global Rotational Diffusion Tensor from NMR Relaxation Measurements
2RU6 2014-02-12 The pure alternative state of ubiquitin
6K4I 2019-10-30 The partially disordered conformation of ubiquitin (Q41N variant)
2KN5 2009-11-17 A Correspondence Between Solution-State Dynamics of an Individual Protein and the Sequence and Conformational Diversity of its Family
2MCN 2014-02-05 Distinct ubiquitin binding modes exhibited by SH3 domains: molecular determinants and functional implications
5VF0 2017-05-17 Solution NMR structure of human RAD18 (198-240) in complex with ubiquitin
2N2K 2015-07-08 Ensemble structure of the closed state of Lys63-linked diubiquitin in the absence of a ligand
5XBO 2017-05-31 Lanthanoid tagging via an unnatural amino acid for protein structure characterization
2KX0 2010-09-08 the solution structure of UBB+1, frameshift mutant of ubiquitin B
2Z59 2008-05-20 Complex Structures of Mouse Rpn13 (22-130aa) and ubiquitin
2MBQ 2013-09-04 K11-linked Diubiquitin average solution structure at pH 6.8, 150 mM NaCl
2LVQ 2012-11-21 gp78CUE domain bound to the proximal ubiquitin of K48-linked diubiquitin
2MBO 2013-09-04 K11-linked Diubiquitin average solution structure at pH 6.8, 0 mM NaCl
1XQQ 2005-02-08 Simultaneous determination of protein structure and dynamics
2LZ6 2013-10-02 Distinct ubiquitin binding modes exhibited by sh3 domains: molecular determinants and functional implications
2MJ5 2014-04-09 Structure of the UBA Domain of Human NBR1 in Complex with Ubiquitin
1G6J 2001-03-28 STRUCTURE OF RECOMBINANT HUMAN UBIQUITIN IN AOT REVERSE MICELLES
2BGF 2005-08-31 NMR structure of Lys48-linked di-ubiquitin using chemical shift perturbation data together with RDCs and 15N-relaxation data
1V81 2005-02-15 Solution structures of ubiquitin at 30 bar and 3 kbar
1V80 2005-02-15 Solution structures of ubiquitin at 30 bar and 3 kbar
5VZM 2018-05-23 Solution NMR structure of human Rev1 (932-1039) in complex with ubiquitin
2JY6 2008-03-18 Solution structure of the complex of ubiquitin and ubiquilin 1 UBA domain
2KDF 2009-09-01 NMR structure of minor S5a (196-306):K48 linked diubiquitin species
2KWV 2010-10-06 Solution Structure of UBM1 of murine Polymerase iota in Complex with Ubiquitin
2MJB 2014-03-26 Solution nmr structure of ubiquitin refined against dipolar couplings in 4 media
5UJL 2017-10-25 Representative 1-conformer ensembles of K27-linked Ub2 from RDC data
2LVO 2012-11-21 Structure of the gp78CUE domain bound to monubiquitin
2KWU 2010-10-06 Solution Structure of UBM2 of murine Polymerase iota in Complex with Ubiquitin
1E0Q 2001-01-16 Mutant Peptide from the first N-terminal 17 amino-acid of Ubiquitin
5YMY 2019-03-13 The structure of the complex between Rpn13 and K48-diUb
2MUR 2014-12-03 Solution Structure of the Human FAAP20 UBZ-Ubiquitin Complex
1Q0W 2003-10-07 Solution structure of Vps27 amino-terminal UIM-ubiquitin complex
1D3Z 1999-10-14 UBIQUITIN NMR STRUCTURE
2L0F 2010-11-03 Solution NMR structure of human polymerase iota UBM2 (P692A mutant) in complex with ubiquitin
2MSG 2015-02-18 Solid-state NMR structure of ubiquitin
2MBB 2014-06-04 Solution Structure of the human Polymerase iota UBM1-Ubiquitin Complex
2L00 2011-07-20 Solution structure of the non-covalent complex of the ZNF216 A20 domain with ubiquitin
6V5D 2020-01-01 EROS3 RDC and NOE Derived Ubiquitin Ensemble
5NVG 2017-05-31 1.07 Thr12 Phosphorylated Ubiquitin
5TOG 2017-05-24 1.08 Room temperature structure of ubiquitin variant u7ub25.2540
5TOF 2017-05-24 1.12 Room temperature structure of ubiquitin variant u7ub25
5GOB 2016-11-02 1.15 Lys6-linked di-ubiquitin
4XOF 2015-10-14 1.15 Observing the overall rocking motion of a protein in a crystal - Orthorhombic Ubiquitin crystals without Zinc.
5GOD 2016-11-02 1.15 Lys27-linked di-ubiquitin
3A9J 2009-12-08 1.18 Crystal structure of the mouse TAB2-NZF in complex with Lys63-linked di-ubiquitin
5W46 2017-07-05 1.18 Structure of S65D Phosphomimetic Ubiquitin Refined at 1.2 Angstroms Resolution
5XVE 2018-02-28 1.24 Crystal structure of human USP2 C276S mutant in complex with ubiquitin
3NHE 2010-06-30 1.26 High Resolution Structure (1.26A) of USP2a in Complex with Ubiquitin
5NL4 2017-04-26 1.32 Crystal structure of Zn1.3-E16V human ubiquitin (hUb) mutant adduct, from a solution 35 mM zinc acetate/1.3 mM E16V hUb
1OGW 2003-05-30 1.32 Synthetic Ubiquitin with fluoro-Leu at 50 and 67
5DK8 2015-12-16 1.32 Human ubiquitin in the P1 space group
2GBJ 2006-05-16 1.35 Crystal Structure of the 9-10 8 Glycine Insertion Mutant of Ubiquitin.
2ZCC 2007-11-20 1.4 Ubiquitin crystallized under high pressure
2WWZ 2009-11-24 1.4 TAB2 NZF DOMAIN IN COMPLEX WITH Lys63-linked di-ubiquitin, P212121
3AI5 2010-09-29 1.4 Crystal structure of yeast enhanced green fluorescent protein-ubiquitin fusion protein
4HK2 2012-11-21 1.4 U7Ub25.2540
4M0W 2014-02-12 1.4 Crystal Structure of SARS-CoV papain-like protease C112S mutant in complex with ubiquitin
4Y1H 2015-03-18 1.4 Crystal structure of K33 linked tri-Ubiquitin
3A9K 2009-12-08 1.4 Crystal structure of the mouse TAB3-NZF in complex with Lys63-linked di-ubiquitin
5V1Y 2017-05-03 1.42 Crystal structure of the ternary RPN13 PRU-RPN2 (940-953)-ubiquitin complex
5KYC 2017-08-09 1.43 Crystal structure of USP7 catalytic domain [V302K] mutant in complex with ubiquitin (malonate bound)
1XD3 2004-11-23 1.45 Crystal structure of UCHL3-UbVME complex
6E2B 2018-11-14 1.45 Ubiquitin in complex with Pt(2-phenilpyridine)(PPh3)
5KYF 2017-08-09 1.45 Crystal structure of USP7 catalytic domain [L299A] mutant in complex with ubiquitin
4IUM 2013-02-13 1.45 Equine arteritis virus papain-like protease 2 (PLP2) covalently bound to ubiquitin
5YT6 2018-07-11 1.5 Crystal structure of TAX1BP1 UBZ2 in complex with mono-ubiquitin
6NYO 2019-08-07 1.5 Crystal structure of a human Cdc34-ubiquitin thioester mimetic
4PIH 2014-10-29 1.5 X-ray crystal structure of the K33S mutant of ubiquitin
4PIJ 2014-10-29 1.5 X-ray crystal structure of the K11S/K63S double mutant of ubiquitin
5NLF 2017-05-03 1.5 Crystal structure of Zn2.7-E16V human ubiquitin (hUb) mutant adduct, from a solution 100 mM zinc acetate/1.3 mM E16V hUb
4UN2 2014-08-27 1.51 Crystal structure of the UBA domain of Dsk2 in complex with Ubiquitin
5NLI 2017-05-03 1.53 Crystal structure of Zn2-E16V human ubiquitin (hUb) mutant adduct, from a solution 35 mM zinc acetate/10% v/v TFE/1.3 mM E16V hUb
5NLJ 2017-04-26 1.53 Crystal structure of Zn3-E16V human ubiquitin (hUb) mutant adduct, from a solution 70 mM zinc acetate/20% v/v TFE/1.3 mM E16V hUb
4V3L 2015-04-08 1.53 RNF38-UB-UbcH5B-Ub complex
4ZPZ 2015-06-10 1.54 Crystal Structure of Semi-synthetic Ubiquitin with Phospho-Ser65 and Ala46Cys
3BY4 2008-02-19 1.55 Structure of Ovarian Tumor (OTU) domain in complex with Ubiquitin
5K9P 2016-07-20 1.55 Ser20 phosphorylated ubiquitin
2GBM 2006-05-16 1.55 Crystal Structure of the 35-36 8 Glycine Insertion Mutant of Ubiquitin
5J8P 2016-05-18 1.55 Lys27-linked diubiquitin
5GOJ 2016-11-02 1.55 Lys63-linked di-ubiquitin
4LJO 2013-10-16 1.56 Structure of an active ligase (HOIP)/ubiquitin transfer complex
5GOI 2016-11-02 1.59 Lys48-linked di-ubiquitin
2ZNV 2008-09-02 1.6 Crystal structure of human AMSH-LP DUB domain in complex with Lys63-linked ubiquitin dimer
6FDK 2018-08-15 1.6 Structure of Chlamydia trachomatis effector protein Cdu1 bound to ubiquitin
2ZCB 2007-11-20 1.6 Crystal Structure of ubiquitin P37A/P38A
5OXH 2017-11-22 1.6 C-terminally retracted ubiquitin T66V/L67N mutant
2GBN 2006-05-16 1.6 Crystal Structure of the 35-36 8 Glycine Insertion Mutant of Ubiquitin
3M3J 2010-03-23 1.6 A new crystal form of Lys48-linked diubiquitin
5KYD 2017-08-09 1.62 Crystal structure of USP7 catalytic domain [V302K] mutant in complex with ubiquitin
5OXI 2017-11-22 1.63 C-terminally retracted ubiquitin L67S mutant
4K1R 2014-04-23 1.63 Crystal structure of Schizosaccharomyces pombe sst2 catalytic domain and Ubiquitin
6HEI 2019-03-27 1.64 Structure of the catalytic domain of USP28 (insertion deleted) bound to Ubiquitin-PA
5X3N 2017-04-12 1.65 Crystal structure of DiUb-K6
4XYZ 2015-03-18 1.65 Crystal structure of K33 linked di-Ubiquitin
5EMZ 2016-11-16 1.66 Crystal structure of K48-linked diubiquitin with F45W mutation in the proximal unit
5AF5 2015-03-25 1.68 Structure of Lys33-linked triUb S.G. P 212121
6HPR 2018-12-12 1.7 Crystal structure of cIAP1 RING domain bound to UbcH5B-Ub and a non-covalent Ub
3V6C 2012-12-19 1.7 Crystal Structure of USP2 in complex with mutated ubiquitin
4I6N 2013-05-29 1.7 Crystal structure of Trichinella spiralis UCH37 catalytic domain bound to Ubiquitin vinyl methyl ester
5NMC 2017-05-03 1.7 Crystal structure of Zn3-hUb(human ubiquitin) adduct from a solution 70 mM zinc acetate/20% v/v TFE/1.3 mM hUb
3B08 2011-12-14 1.7 Crystal structure of the mouse HOIL1-L-NZF in complex with linear di-ubiquitin
3VUX 2013-02-13 1.7 Crystal structure of A20 ZF7 in complex with linear ubiquitin, form II
6B7M 2018-04-18 1.7 Crystal structure of Legionella effector sdeD (lpg2509) in complex with Ubiquitin
1P3Q 2003-06-24 1.7 Mechanism of Ubiquitin Recognition by the CUE Domain of VPS9
1BT0 1998-12-30 1.7 STRUCTURE OF UBIQUITIN-LIKE PROTEIN, RUB1
2D3G 2005-12-20 1.7 Double sided ubiquitin binding of Hrs-UIM
6A42 2018-10-24 1.7 R1EN(5-223)-ubiquitin fusion
3NS8 2011-07-20 1.71 Crystal structure of an open conformation of Lys48-linked diubiquitin at pH 7.5
4ZFR 2015-10-14 1.72 Catalytic domain of Sst2 F403A mutant bound to ubiquitin
6EI1 2018-03-07 1.73 Crystal structure of the covalent complex between deubiquitinase ZUFSP (ZUP1) and Ubiquitin-PA
5GOC 2016-11-02 1.73 Lys11-linked diubiquitin
6FGE 2018-04-04 1.74 Crystal structure of human ZUFSP/ZUP1 in complex with ubiquitin
4MSM 2014-06-18 1.74 Crystal structure of Schizosaccharomyces pombe AMSH-like protease sst2 E286A mutant bound to ubiquitin
1WRD 2005-10-11 1.75 Crystal structure of Tom1 GAT domain in complex with ubiquitin
4K7S 2013-05-08 1.76 Crystal structure of Zn2-hUb (human ubiquitin) adduct from a solution 35 mM zinc acetate/1.3 mM hUb
4K7U 2013-05-08 1.76 Crystal structure of Zn2.3-hUb (human ubiquitin) adduct from a solution 70 mM zinc acetate/1.3 mM hUb
4K7W 2013-05-08 1.76 Crystal structure of Zn3-hUb(human ubiquitin) adduct from a solution 100 mM zinc acetate/1.3 mM hUb
6OI4 2019-05-15 1.76 RPN13 (19-132)-RPN2 (940-952) pY950-Ub complex
5XIS 2018-03-07 1.78 Crystal structure of RNF168 UDM1 in complex with Lys63-linked diubiquitin, form I
4HJK 2012-11-21 1.78 U7Ub7 Disulfide variant
3N32 2011-01-12 1.79 The crystal structure of human Ubiquitin adduct with Zeise's salt
5M93 2016-12-14 1.79 Crystal structure of SdeA-modified ubiquitin.
5XIU 2018-03-07 1.8 Crystal structure of RNF168 UDM2 in complex with Lys63-linked diubiquitin
4ZQS 2016-04-20 1.8 New compact conformation of linear Ub2 structure
2J7Q 2007-03-20 1.8 Crystal structure of the ubiquitin-specific protease encoded by murine cytomegalovirus tegument protein M48 in complex with a ubquitin-based suicide substrate
1UBQ 1987-04-16 1.8 STRUCTURE OF UBIQUITIN REFINED AT 1.8 ANGSTROMS RESOLUTION
5ULF 2017-06-07 1.8 Crystal Structure of a UbcH5b~Ub conjugate
6GLC 2018-06-13 1.8 Structure of phospho-Parkin bound to phospho-ubiquitin
5GO7 2016-11-02 1.8 Linear tri-ubiquitin
3ONS 2011-02-23 1.8 Crystal structure of Human Ubiquitin in a new crystal form
3K9O 2010-09-08 1.8 The crystal structure of E2-25K and UBB+1 complex
1UBI 1994-05-31 1.8 SYNTHETIC STRUCTURAL AND BIOLOGICAL STUDIES OF THE UBIQUITIN SYSTEM. PART 1
3EHV 2009-03-17 1.81 X-ray structure of human ubiquitin Zn(II) adduct
5XU8 2018-02-28 1.81 Crystal structure of human USP2 in complex with ubiquitin and 6-thioguanine
5X3M 2017-04-05 1.82 crystal structure of p-Ub-S65-NH2
5TXK 2018-05-09 1.84 CRYSTAL STRUCTURE OF USP35 C450S IN COMPLEX WITH UBIQUITIN
3EFU 2008-12-09 1.84 X-ray structure of human ubiquitin-Hg(II) adduct
5GOK 2016-11-02 1.84 K11/K63-branched tri-Ubiquitin
3ALB 2010-08-25 1.85 Cyclic Lys48-linked tetraubiquitin
2HD5 2006-08-15 1.85 USP2 in complex with ubiquitin
5WFI 2018-08-01 1.85 X-ray structure of MHV PLP2 (Cys1716Ser) catalytic mutant in complex with free ubiquitin
2QHO 2007-09-25 1.85 Crystal structure of the UBA domain from EDD ubiquitin ligase in complex with ubiquitin
5L8H 2016-09-28 1.85 Structure of USP46-UbVME
5AF4 2015-03-25 1.85 Structure of Lys33-linked diUb
6B7O 2018-04-18 1.85 Crystal structure of Legionella effector sdeD (lpg2509) H67A in complex with ADP-ribosylated Ubiquitin
1UZX 2004-03-30 1.85 A complex of the Vps23 UEV with ubiquitin
4Q5E 2014-07-02 1.87 Shigella Effector Kinase OspG bound to E2-Ub UbcH7-Ub Conjugate
6ISU 2019-02-06 1.87 Crystal structure of Lys27-linked di-ubiquitin in complex with its selective interacting protein UCHL3
5GVI 2017-09-13 1.87 Zebrafish USP30 in complex with Lys6-linked diubiquitin
3MHS 2010-04-21 1.89 Structure of the SAGA Ubp8/Sgf11/Sus1/Sgf73 DUB module bound to ubiquitin aldehyde
2OOB 2007-02-06 1.9 crystal structure of the UBA domain from Cbl-b ubiquitin ligase in complex with ubiquitin
6GZS 2018-11-14 1.9 Structure of Chlamydia trachomatis effector protein ChlaDUB1 bound to ubiquitin
3B0A 2011-12-14 1.9 Crystal structure of the mouse HOIL1-L-NZF in complex with linear di-ubiquitin
3H7P 2009-09-22 1.9 Crystal structure of K63-linked di-ubiquitin
3ZNZ 2013-06-26 1.9 Crystal structure of OTULIN OTU domain (C129A) in complex with Met1- di ubiquitin
4LDT 2013-08-14 1.9 The structure of h/ceOTUB1-ubiquitin aldehyde-UBCH5B~Ub
5CVM 2015-10-07 1.9 USP46~ubiquitin BEA covalent complex
4WZP 2015-01-14 1.9 Ser65 phosphorylated ubiquitin, major conformation
3WWQ 2015-05-13 1.9 Crystal structure of FAAP20 UBZ domain in complex with Lys63-linked diubiquitin
5D0M 2015-12-09 1.91 Structure of UbE2D2:RNF165:Ub complex
3TMP 2012-01-11 1.91 The catalytic domain of human deubiquitinase DUBA in complex with ubiquitin aldehyde
2JF5 2008-02-05 1.95 crystal structure of Lys63-linked di-ubiquitin
4MSQ 2014-06-18 1.95 Crystal structure of Schizosaccharomyces pombe AMSH-like protease sst2 catalytic domain bound to ubiquitin
6N6R 2019-07-17 1.95 Crystal structure of ABIN-1 UBAN in complex with two M1-linked di-ubiquitins
5GOH 2016-11-02 1.95 Lys33-linked di-ubiquitin
5ULH 2017-06-07 1.95 Structure of RNF165 in complex with a UbcH5b~Ub conjugate
4PIG 2014-10-29 1.95 Crystal structure of the ubiquitin K11S mutant
3VUW 2013-02-13 1.95 Crystal structure of A20 ZF7 in complex with linear ubiquitin, form I
3HM3 2009-08-25 1.96 The Structure and conformation of Lys-63 linked tetra-ubiquitin
5NL5 2017-04-26 1.96 Crystal structure of Zn1.7-E16V human ubiquitin (hUb) mutant adduct, from a solution 70 mM zinc acetate/1.3 mM E16V hUb
5KYE 2017-08-09 1.97 Crystal structure of USP7 catalytic domain [H294E] mutant in complex with ubiquitin
3VUY 2013-02-13 1.98 Crystal structure of A20 ZF7 in complex with linear tetraubiquitin
5GOG 2016-11-02 1.98 Lys29-linked di-ubiquitin
2GBK 2006-05-16 1.99 Crystal Structure of the 9-10 MoaD Insertion Mutant of Ubiquitin
5JBY 2016-07-20 1.99 Lys27-linked triubiquitin
2G45 2006-04-04 1.99 Co-crystal structure of znf ubp domain from the deubiquitinating enzyme isopeptidase T (isot) in complex with ubiquitin
2GBR 2006-05-16 2.0 Crystal Structure of the 35-36 MoaD Insertion Mutant of Ubiquitin
5V1Z 2017-05-03 2.0 Crystal structure of the RPN13 PRU-RPN2 (932-953)-ubiquitin complex
5YDR 2018-02-21 2.0 Structure of DNMT1 RFTS domain in complex with ubiquitin
3PHW 2011-02-02 2.0 OTU Domain of Crimean Congo Hemorrhagic Fever Virus in complex with Ubiquitin
4IG7 2013-05-29 2.0 Crystal structure of Trichinella spiralis UCH37 bound to Ubiquitin vinyl methyl ester
5WVO 2017-11-15 2.0 Crystal structure of DNMT1 RFTS domain in complex with K18/K23 mono-ubiquitylated histone H3
4Q5H 2014-07-02 2.0 Shigella Effector Kinase OspG bound to AMPPNP and E2-Ub UbcH7-Ub Conjugate
5LRW 2016-10-19 2.0 Structure of Cezanne/OTUD7B OTU domain bound to ubiquitin
5JG6 2016-06-15 2.0 APC11-Ubv shows role of noncovalent RING-Ubiquitin interactions in processive multiubiquitination and Ubiquitin chain elongation by APC/C
1S1Q 2004-05-04 2.0 TSG101(UEV) domain in complex with Ubiquitin
4WLR 2015-03-04 2.0 Crystal Structure of mUCH37-hRPN13 CTD-hUb complex
4V3K 2015-04-08 2.04 RNF38-UbcH5B-UB complex
5HPS 2016-03-16 2.05 System-wide modulation of HECT E3 ligases with selective ubiquitin variant probes: WWP1 and UbV P1.1
4FJV 2013-06-12 2.05 Crystal Structure of Human Otubain2 and Ubiquitin Complex
5MN9 2017-01-25 2.05 Crystal structure of MINDY-1 tMIU in complex with K48-diUb
6NYA 2019-08-07 2.07 Crystal Structure of ubiquitin E1 (Uba1) in complex with Ubc3 (Cdc34) and ubiquitin
4XKL 2015-11-11 2.1 Crystal structure of NDP52 ZF2 in complex with mono-ubiquitin
5DFL 2015-12-02 2.1 Crystal structure of Ube2K~Ubiquitin conjugate
3V6E 2012-12-19 2.1 Crystal Structure of USP2 and a mutant form of Ubiquitin
6JB7 2019-03-20 2.1 Crystal structure of Ub-conjugated Ube2K C92K&K97A mutant (isopeptide linkage), 2.1 A resolution
2C7N 2006-02-15 2.1 Human Rabex-5 residues 1-74 in complex with Ubiquitin
6AQR 2018-07-04 2.1 SAGA DUB module Ubp8(C146A)/Sgf11/Sus1/Sgf73 bound to monoubiquitin
5JBV 2016-05-18 2.1 Lys27-linked triubiquitin
5BZ0 2016-06-15 2.1 Crystal structure of IBV papain-like protease PLpro C101S mutant in complex with ubiquitin
4RF1 2014-10-22 2.15 Crystal structure of the Middle-East respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group P63)
4LJP 2013-10-16 2.15 Structure of an active ligase (HOIP-H889A)/ubiquitin transfer complex
5MNJ 2017-05-31 2.16 Structure of MDM2-MDMX-UbcH5B-ubiquitin complex
3Q3F 2012-01-25 2.17 Engineering Domain-Swapped Binding Interfaces by Mutually Exclusive Folding: Insertion of Ubiquitin into position 103 of Barnase
5ZQ3 2018-05-23 2.18 PDE-Ubiquitin
4AUQ 2012-08-15 2.18 Structure of BIRC7-UbcH5b-Ub complex.
1SIF 2004-07-27 2.18 Crystal structure of a multiple hydrophobic core mutant of ubiquitin
3AXC 2012-01-25 2.19 Crystal structure of linear diubiquitin
3NOB 2010-08-11 2.19 Structure of K11-linked di-ubiquitin
5X3O 2017-04-12 2.19 Crystal structure of p-DiUb-S65-COOH
3A1Q 2009-07-21 2.2 Crystal structure of the mouse RAP80 UIMs in complex with Lys63-linked di-ubiquitin
4II2 2013-02-13 2.2 Crystal structure of Ubiquitin activating enzyme 1 (Uba1) in complex with the Ub E2 Ubc4, ubiquitin, and ATP/Mg
2XEW 2010-07-14 2.2 Crystal structure of K11-linked diubiquitin
6OQ1 2019-10-23 2.2 Crystal Structure of Branched K11/K48-Linked Tri-Ubiquitin
2O6V 2007-02-13 2.2 Crystal structure and solution NMR studies of Lys48-linked tetraubiquitin at neutral pH
3A33 2009-11-24 2.2 UbcH5b~Ubiquitin Conjugate
4XOK 2015-10-14 2.2 Observing the overall rocking motion of a protein in a crystal.
6NXK 2020-01-15 2.2 Ubiquitin binding variants
5IFR 2016-05-11 2.2 Structure of the stable UBE2D3-UbDha conjugate
2IBI 2006-10-24 2.2 Covalent Ubiquitin-USP2 Complex
5TR4 2017-11-01 2.2 Structure of Ubiquitin activating enzyme (Uba1) in complex with ubiquitin and TAK-243
3ZNI 2013-07-10 2.21 Structure of phosphoTyr363-Cbl-b - UbcH5B-Ub - ZAP-70 peptide complex
5GO8 2016-11-02 2.21 Linear tetra-ubiquitin
5AIU 2015-07-08 2.21 A complex of RNF4-RING domain, Ubc13-Ub (isopeptide crosslink)
6RYA 2019-11-13 2.21 Structure of Dup1 mutant H67A:Ubiquitin complex
4AP4 2012-07-25 2.21 Rnf4 - ubch5a - ubiquitin heterotrimeric complex
5ZQ4 2018-05-23 2.22 PDE-Ubi-ADPr
6QK9 2019-07-24 2.23 A dimeric ubiquitin formed by a single amino acid substitution
5XIT 2018-03-07 2.25 Crystal structure of RNF168 UDM1 in complex with Lys63-linked diubiquitin, form II
2W9N 2009-04-28 2.25 crystal structure of linear di-ubiquitin
1CMX 1999-07-27 2.25 STRUCTURAL BASIS FOR THE SPECIFICITY OF UBIQUITIN C-TERMINAL HYDROLASES
5XPK 2017-07-19 2.27 Crystal structure of ubiquitin-k6mimic
5VZW 2017-08-09 2.28 TRIM23 RING domain in complex with UbcH5-Ub
4R62 2015-09-02 2.28 Structure of Rad6~Ub
1NBF 2003-01-07 2.3 Crystal structure of a UBP-family deubiquitinating enzyme in isolation and in complex with ubiquitin aldehyde
3WXF 2015-02-11 2.3 Crystal structure of CYLD USP domain (C596S E674Q) in complex with Met1-linked diubiquitin
1AAR 1993-10-31 2.3 STRUCTURE OF A DIUBIQUITIN CONJUGATE AND A MODEL FOR INTERACTION WITH UBIQUITIN CONJUGATING ENZYME (E2)
3ZNH 2013-02-27 2.3 Crimean Congo Hemorrhagic Fever Virus OTU domain in complex with ubiquitin-propargyl.
5L6H 2017-06-14 2.3 Uba1 in complex with Ub-ABPA3 covalent adduct
4Z9S 2015-07-29 2.3 Non-covalent assembly of monoubiquitin that mimics K11 poly-ubiquitin
4UEL 2015-03-04 2.3 UCH-L5 in complex with ubiquitin-propargyl bound to the RPN13 DEUBAD domain
6PGV 2019-10-23 2.3 Human Josephin-2 in complex with ubiquitin
4ZFT 2015-10-14 2.3 Catalytic domain of Sst2 F403W mutant bound to ubiquitin
4S22 2015-04-08 2.3 Crystal structure of K29 linked di-Ubiquitin
3PRM 2011-01-26 2.3 Structural analysis of a viral OTU domain protease from the Crimean-Congo Hemorrhagic Fever virus in complex with human ubiquitin
3H7S 2009-09-22 2.3 Crystal structures of K63-linked di- and tri-ubiquitin reveal a highly extended chain architecture
2WDT 2009-12-29 2.3 Crystal structure of Plasmodium falciparum UCHL3 in complex with the suicide inhibitor UbVME
4NQL 2014-10-08 2.3 The crystal structure of the DUB domain of AMSH orthologue, Sst2 from S. pombe, in complex with lysine 63-linked diubiquitin
5HPL 2016-03-16 2.31 System-wide modulation of HECT E3 ligases with selective ubiquitin variant probes: Rsp5 and UbV R5.4
3C0R 2008-02-19 2.32 Structure of Ovarian Tumor (OTU) domain in complex with Ubiquitin
5FER 2016-05-18 2.34 Complex of TRIM25 RING with UbcH5-Ub
5OHK 2017-09-20 2.34 Crystal structure of USP30 in covalent complex with ubiquitin propargylamide (high resolution)
6DGF 2019-02-13 2.34 Ubiquitin Variant bound to USP2
4BOS 2013-07-24 2.35 Structure of OTUD2 OTU domain in complex with Ubiquitin K11-linked peptide
3UGB 2012-05-16 2.35 UbcH5c~Ubiquitin Conjugate
4DHJ 2012-02-22 2.35 The structure of a ceOTUB1 ubiquitin aldehyde UBC13~Ub complex
3OFI 2010-09-08 2.35 Crystal structure of human insulin-degrading enzyme in complex with ubiquitin
6ASR 2018-06-20 2.36 REV1 UBM2 domain complex with ubiquitin
5XDP 2017-04-19 2.38 K11/48-branched teraubiquitin
5ULK 2017-06-07 2.38 Crystal Structure of RNF165 in complex with a UbcH5b~Ub conjugate
3AUL 2011-09-07 2.39 Crystal structure of wild-type Lys48-linked diubiquitin in an open conformation
3IFW 2010-06-16 2.4 Crystal structure of the S18Y variant of ubiquitin carboxy terminal hydrolase L1 bound to ubiquitin vinylmethylester.
4NNJ 2014-05-07 2.4 Crystal structure of Uba1 in complex with ubiquitin-AMP and thioesterified ubiquitin
6A43 2018-10-24 2.4 R1EN(5-225)-ubiquitin fusion
2WX0 2009-11-24 2.4 TAB2 NZF DOMAIN IN COMPLEX WITH Lys63-linked di-ubiquitin, P21
5EYA 2016-08-17 2.4 TRIM25 RING domain in complex with Ubc13-Ub conjugate
2C7M 2006-02-15 2.4 Human Rabex-5 residues 1-74 in complex with Ubiquitin
4KSK 2013-06-05 2.4 Gumby/Fam105B in complex with ubiquitin
3VDZ 2012-11-28 2.4 Tailoring Encodable Lanthanide-Binding Tags as MRI Contrast Agents: xq-dSE3-Ubiquitin at 2.4 Angstroms
1TBE 1994-01-31 2.4 STRUCTURE OF TETRAUBIQUITIN SHOWS HOW MULTIUBIQUITIN CHAINS CAN BE FORMED
6A44 2018-10-24 2.4 R1EN(5-227)-ubiquitin fusion
3VHT 2012-10-10 2.4 Crystal structure of GFP-Wrnip1 UBZ domain fusion protein in complex with ubiquitin
3U30 2012-01-18 2.43 Crystal structure of a linear-specific Ubiquitin fab bound to linear ubiquitin
5HPK 2016-03-16 2.43 System-wide modulation of HECT E3 ligases with selective ubiquitin variant probes: NEDD4L and UbV NL.1
6IF1 2018-11-21 2.47 Crystal structure of Ube2K and K48-linked di-ubiquitin complex
4I6L 2013-01-16 2.49 Crystal structure of OTUB1 in complex with ubiquitin variant
5ZQ5 2018-05-23 2.49 SidE-Ubi
2FIF 2006-02-07 2.49 Crystal Structure of a Bovine Rabex-5 fragment complexed with ubiquitin
5BNB 2016-02-17 2.49 Crystal structure of a Ube2S-ubiquitin conjugate
3OLM 2011-03-23 2.49 Structure and Function of a Ubiquitin Binding Site within the Catalytic Domain of a HECT Ubiquitin Ligase
5U4P 2017-09-06 2.5 Protein-protein complex between 26S proteasome regulatory subunit RPN8, RPN11, and Ubiquitin S31
5IBK 2016-03-30 2.5 Skp1-F-box in complex with a ubiquitin variant
5OHL 2017-10-04 2.5 K6-specific affimer bound to K6 diUb
3OJ3 2010-12-08 2.5 Crystal structure of the A20 ZnF4 and ubiquitin complex
6FX4 2018-07-11 2.5 Disulfide between E3 HECT ligase Smurf2 and Ubiquitin G76C
3RUL 2012-06-06 2.5 New strategy to analyze structures of glycopeptide-target complexes
3PT2 2011-01-19 2.5 Structure of a viral OTU domain protease bound to Ubiquitin
2GMI 2006-09-19 2.5 Mms2/Ubc13~Ubiquitin
3WXE 2015-02-11 2.5 Crystal structure of CYLD USP domain (C596S) in complex with Met1-linked diubiquitin
5J26 2016-12-14 2.5 Crystal structure of a 53BP1 Tudor domain in complex with a ubiquitin variant
5YDK 2018-03-07 2.51 Crystal structure of RNF168 UDM1 in complex with Lys63-linked diubiquitin, tetrameric form
4BBN 2013-05-01 2.51 NEDD4 HECT-Ub:Ub complex
3I3T 2009-07-21 2.59 Crystal structure of covalent ubiquitin-USP21 complex
5H07 2017-03-08 2.59 TNIP2-Ub complex, C2 form
4HCN 2012-11-21 2.6 Crystal structure of Burkholderia pseudomallei effector protein CHBP in complex with ubiquitin
5TUT 2017-11-08 2.6 UbcH5a-Ub isopeptide conjugate
3DVG 2008-09-30 2.6 Crystal structure of K63-specific fab Apu.3A8 bound to K63-linked di-ubiquitin
6O82 2019-06-19 2.6 S. pombe ubiquitin E1 complex with a ubiquitin-AMP mimic
6T4Q 2019-12-25 2.6 Structure of yeast 80S ribosome stalled on the CGA-CCG inhibitory codon combination.
6A6I 2019-02-13 2.6 Crystal structure of the winged-helix domain of Cockayne syndrome group B protein in complex with ubiquitin
3LDZ 2010-03-02 2.6 Crystal structure of human STAM1 VHS domain in complex with ubiquitin
5N38 2017-04-19 2.6 S65DParkin and pUB complex
3N3K 2010-06-23 2.6 The catalytic domain of USP8 in complex with a USP8 specific inhibitor
1WR6 2005-06-28 2.6 Crystal structure of GGA3 GAT domain in complex with ubiquitin
2OJR 2007-06-12 2.6 Structure of ubiquitin solved by SAD using the Lanthanide-Binding Tag
4MDK 2013-12-11 2.61 Cdc34-ubiquitin-CC0651 complex
6BYH 2018-07-18 2.61 Ubiquitin Variant (UbV.Fl11.1) bound to a human Skp1-Fbl11 fragment complex.
5CAW 2015-07-22 2.62 Structure of Pediculus humanus Parkin bound to phospho-ubiquitin
5CRA 2015-11-25 2.64 Structure of the SdeA DUB Domain
5D0K 2015-12-09 2.65 Structure of UbE2D2:RNF165:Ub complex
5JQS 2016-06-22 2.65 Crystal structure of deubiquitinase MINDY-1 in complex with Ubiquitin
6BVA 2018-07-18 2.66 Ubiquitin Variant (UbV.Fl10.1) bound to a human Skp1-Fbl10 fragment complex.
2XBB 2011-03-23 2.68 Nedd4 HECT:Ub complex
5N2W 2017-04-19 2.68 WT-Parkin and pUB complex
5L6J 2017-06-14 2.68 Uba1 in complex with Ub-MLN7243 covalent adduct
5B83 2016-09-07 2.69 Crystal structure of Optineurin UBAN in complex with linear ubiquitin
2HTH 2006-10-24 2.7 Structural basis for ubiquitin recognition by the human EAP45/ESCRT-II GLUE domain
3DVN 2008-09-30 2.7 Crystal structure of K63-specific fab Apu2.16 bound to K63-linked di-ubiquitin
3PTF 2011-05-11 2.7 X-ray structure of the non-covalent complex between UbcH5A and Ubiquitin
4BVU 2014-01-29 2.7 Structure of Shigella effector OspG in complex with host UbcH5c- Ubiquitin conjugate
2Y5B 2012-01-25 2.7 Structure of USP21 in complex with linear diubiquitin-aldehyde
3CMM 2008-08-05 2.7 Crystal Structure of the Uba1-Ubiquitin Complex
3JSV 2009-10-27 2.7 Crystal structure of mouse NEMO CoZi in complex with Lys63-linked di-ubiquitin
3O65 2010-11-24 2.7 Crystal structure of a Josephin-ubiquitin complex: Evolutionary restraints on ataxin-3 deubiquitinating activity
3MTN 2010-06-09 2.7 Usp21 in complex with a ubiquitin-based, USP21-specific inhibitor
1F9J 2001-02-07 2.7 STRUCTURE OF A NEW CRYSTAL FORM OF TETRAUBIQUITIN
6JB6 2019-03-20 2.7 Crystal structure of Ub-conjugated Ube2K C92K&K97A mutant (isopeptide linkage), 2.7 A resolution
4MM3 2014-07-02 2.75 Crystal structure of SARS-CoV papain-like protease PLpro in complex with ubiquitin aldehyde
5L6I 2017-06-14 2.76 Uba1 in complex with Ub-MLN4924 covalent adduct
5L8W 2016-09-28 2.79 Structure of USP12-UB-PRG/UAF1
4RF0 2014-10-22 2.8 Crystal structure of the Middle-East respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group P6522)
1YD8 2005-02-22 2.8 COMPLEX OF HUMAN GGA3 GAT DOMAIN AND UBIQUITIN
4U4R 2014-10-22 2.8 Crystal structure of Lactimidomycin bound to the yeast 80S ribosome
5OHP 2017-09-20 2.8 Crystal structure of USP30 (C77A) in complex with Lys6-linked diubiquitin
3VFK 2013-01-09 2.8 The structure of monodechloro-teicoplanin in complex with its ligand, using ubiquitin as a ligand carrier
3L0W 2010-03-23 2.8 Structure of split monoubiquitinated PCNA with ubiquitin in position two
5LRV 2016-10-19 2.8 Structure of Cezanne/OTUD7B OTU domain bound to Lys11-linked diubiquitin
6S53 2019-09-11 2.8 Crystal structure of TRIM21 RING domain in complex with an isopeptide-linked Ube2N~ubiquitin conjugate
3L10 2010-03-23 2.8 Structure of split monoubiquitinated PCNA with ubiquitin in position one
2FID 2006-02-07 2.8 Crystal Structure of a Bovine Rabex-5 fragment complexed with ubiquitin
3K9P 2010-09-08 2.8 The crystal structure of E2-25K and ubiquitin complex
3KVF 2010-06-16 2.8 Crystal structure of the I93M mutant of ubiquitin carboxy terminal hydrolase L1 bound to ubiquitin vinylmethylester
5OHV 2017-10-04 2.8 K33-specific affimer bound to K33 diUb
3IHP 2009-12-29 2.8 Covalent Ubiquitin-Usp5 Complex
4KSL 2013-06-05 2.83 Gumby/Fam105B in complex with linear di-ubiquitin
3KW5 2010-06-16 2.83 Crystal structure of ubiquitin carboxy terminal hydrolase L1 bound to ubiquitin vinylmethylester
5HPT 2016-03-16 2.84 System-wide modulation of HECT E3 ligases with selective ubiquitin variant probes: WWP1, Ubv P2.3 and UBCH7
5ZQ7 2018-05-23 2.85 SidE-Ubi-NAD
4HXD 2013-02-13 2.85 Diversity of ubiquitin and ISG15 specificity amongst nairoviruses viral ovarian tumor domain proteases
5LRX 2016-10-19 2.85 Structure of A20 OTU domain bound to ubiquitin
5E6J 2016-05-18 2.85 Structure of SARS PLpro bound to a Lys48-linked di-ubiquitin activity based probe
4JQW 2014-03-26 2.9 Crystal Structure of a Complex of NOD1 CARD and Ubiquitin
6CP2 2018-08-01 2.9 SidC in complex with UbcH7~Ub
4U3U 2014-10-22 2.9 Crystal structure of Cycloheximide bound to the yeast 80S ribosome
6EK0 2018-01-24 2.9 High-resolution cryo-EM structure of the human 80S ribosome
6QZP 2019-04-24 2.9 High-resolution cryo-EM structure of the human 80S ribosome
2ZVO 2009-03-24 2.9 NEMO CoZi domain in complex with diubiquitin in C2 space group
3ZLZ 2013-04-10 2.9 Lys6-linked tri-ubiquitin
4II3 2013-02-13 2.9 Crystal structure of S. pombe Ubiquitin activating enzyme 1 (Uba1) in complex with ubiquitin and ATP/Mg
3TBL 2012-05-23 2.9 Structure of Mono-ubiquitinated PCNA: Implications for DNA Polymerase Switching and Okazaki Fragment Maturation
5JP3 2016-07-27 2.9 Structure of Xanthomonas campestris effector protein XopD bound to ubiquitin
6FYH 2018-07-11 2.91 Disulfide between ubiquitin G76C and the E3 HECT ligase Huwe1
4XOL 2015-10-14 2.91 Observing the overall rocking motion of a protein in a crystal - Cubic Ubiquitin crystals.
5OE7 2017-09-27 2.95 Structure of OTULIN bound to the Met1-linked diubiquitin activity probe
5TBW 2017-07-26 3.0 Crystal structure of chlorolissoclimide bound to the yeast 80S ribosome
3N30 2011-01-12 3.0 Crystal Structure of cubic Zn3-hUb (human ubiquitin) adduct
3EEC 2009-03-10 3.0 X-ray structure of human ubiquitin Cd(II) adduct
5C7J 2016-03-16 3.0 CRYSTAL STRUCTURE OF NEDD4 WITH A UB VARIANT
4XKH 2016-02-17 3.0 CRYSTAL STRUCTURE OF THE AIRAPL TANDEM UIMS IN COMPLEX WITH A LYS48-LINKED TRI-UBIQUITIN
3PHD 2011-02-23 3.0 Crystal structure of human HDAC6 in complex with ubiquitin
3H1U 2009-05-05 3.0 Structure of ubiquitin in complex with Cd ions
5WQ4 2017-12-06 3.0 Crystal structure of OPTN and linear diubiquitin complex
6MSB 2018-12-05 3.0 Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome
2XK5 2010-08-25 3.0 Crystal structure of K6-linked diubiquitin
4U4Q 2014-10-22 3.0 Crystal structure of Homoharringtonine bound to the yeast 80S ribosome
4U4U 2014-10-22 3.0 Crystal structure of Lycorine bound to the yeast 80S ribosome
4V88 2014-07-09 3.0 The structure of the eukaryotic ribosome at 3.0 A resolution.
2WX1 2009-11-24 3.0 TAB2 NZF DOMAIN IN COMPLEX WITH Lys63-linked tri-ubiquitin, P212121
4U52 2014-10-22 3.0 Crystal structure of Nagilactone C bound to the yeast 80S ribosome
2ZVN 2009-03-24 3.0 NEMO CoZi domain incomplex with diubiquitin in P212121 space group
4U3M 2014-10-22 3.0 Crystal structure of Anisomycin bound to the yeast 80S ribosome
5ZQ6 2018-05-23 3.01 SidE-Ubi-ADPr
6N5M 2019-07-17 3.01 Crystal structure of ABIN-1 UBAN in complex with one M1-linked di-ubiquitin
6FYY 2018-12-05 3.02 Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain (model C2)
4S1Z 2015-04-08 3.03 Crystal structure of TRABID NZF1 in complex with K29 linked di-Ubiquitin
4BOZ 2013-07-17 3.03 Structure of OTUD2 OTU domain in complex with K11-linked di ubiquitin
5C7M 2016-03-16 3.03 CRYSTAL STRUCTURE OF E3 LIGASE ITCH WITH A UB VARIANT
6HEK 2019-03-27 3.03 Structure of human USP28 bound to Ubiquitin-PA
5DGV 2016-12-14 3.1 Complex of yeast 80S ribosome with hypusine-containing/non-modified eIF5A and/or a peptidyl-tRNA analog
6OLE 2019-06-19 3.1 Human ribosome nascent chain complex (CDH1-RNC) stalled by a drug-like molecule with AP and PE tRNAs
4U4Z 2014-10-22 3.1 Crystal structure of Phyllanthoside bound to the yeast 80S ribosome
5I4L 2016-06-22 3.1 Crystal structure of Amicoumacin A bound to the yeast 80S ribosome
6HHQ 2019-02-20 3.1 Crystal structure of compound C45 bound to the yeast 80S ribosome
6T7T 2019-12-25 3.1 Structure of yeast 80S ribosome stalled on poly(A) tract.
6QIK 2019-06-26 3.1 Cryo-EM structures of Lsg1-TAP pre-60S ribosomal particles
6Q8Y 2019-03-13 3.1 Cryo-EM structure of the mRNA translating and degrading yeast 80S ribosome-Xrn1 nuclease complex
6EQI 2017-11-08 3.1 Structure of PINK1 bound to ubiquitin
6OM0 2019-06-19 3.1 Human ribosome nascent chain complex (PCSK9-RNC) stalled by a drug-like molecule with AP and PE tRNAs
5ON6 2018-02-28 3.1 Crystal structure of haemanthamine bound to the 80S ribosome
5FCJ 2016-05-11 3.1 Structure of the anisomycin-containing uL3 W255C mutant 80S yeast ribosome
3JW0 2010-01-12 3.1 E2~Ubiquitin-HECT
4U6F 2014-10-22 3.1 Crystal structure of T-2 toxin bound to the yeast 80S ribosome
4LCD 2013-08-14 3.1 Structure of an Rsp5xUbxSna3 complex: Mechanism of ubiquitin ligation and lysine prioritization by a HECT E3
5YIK 2018-05-30 3.1 Structure of a Legionella effector with its substrate
4U4N 2014-10-22 3.1 Crystal structure of Edeine bound to the yeast 80S ribosome
3WXG 2015-02-11 3.1 Crystal structure of CYLD USP domain (C596A) in complex with Lys63-linked diubiquitin
4DHZ 2012-02-22 3.11 The structure of h/ceOTUB1-ubiquitin aldehyde-UBC13~Ub
5LN1 2016-10-19 3.14 STRUCTURE OF UBIQUITYLATED-RPN10 FROM YEAST;
6DC6 2018-10-10 3.14 Crystal structure of human ubiquitin activating enzyme E1 (Uba1) in complex with ubiquitin
5O44 2017-11-08 3.14 Crystal structure of unbranched mixed tri-Ubiquitin chain containing K48 and K63 linkages.
6O83 2019-06-19 3.15 S. pombe ubiquitin E1~ubiquitin-AMP tetrahedral intermediate mimic
5DAT 2016-08-31 3.15 Complex of yeast 80S ribosome with hypusine-containing eIF5A
4WUR 2014-11-26 3.16 The crystal structure of the MERS-CoV papain-like protease (C111S) with human ubiquitin
5YIJ 2018-05-30 3.18 Structure of a Legionella effector with substrates
4U3N 2014-10-22 3.2 Crystal structure of CCA trinucleotide bound to the yeast 80S ribosome
5ZBU 2019-02-27 3.2 Crystal Structure of PA-TM-RING E3 ligase RNF13 RING domain in complex with E2~Ub
4U55 2014-10-22 3.2 Crystal structure of Cryptopleurine bound to the yeast 80S ribosome
4U4Y 2014-10-22 3.2 Crystal structure of Pactamycin bound to the yeast 80S ribosome
6T7I 2019-12-25 3.2 Structure of yeast 80S ribosome stalled on the CGA-CGA inhibitory codon combination.
4U51 2014-10-22 3.2 Crystal structure of Narciclasine bound to the yeast 80S ribosome
4U50 2014-10-22 3.2 Crystal structure of Verrucarin bound to the yeast 80S ribosome
6KIU 2019-09-11 3.2 Cryo-EM structure of human MLL1-ubNCP complex (3.2 angstrom)
6MSD 2018-12-05 3.2 Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome
5UDH 2017-06-14 3.24 HHARI/ARIH1-UBCH7~Ubiquitin
5LYB 2016-11-23 3.25 Crystal structure of the S.cerevisiae 80S ribosome in complex with the A-site bound aminoacyl-tRNA analog ACCPmn
5DC3 2016-06-01 3.25 Complex of yeast 80S ribosome with non-modified eIF5A
6C16 2018-07-18 3.27 Ubiquitin variant (UbV.Fbl10.1) bound to a human Skp1-Fbl11 fragment complex.
6S47 2019-07-24 3.28 Saccharomyces cerevisiae 80S ribosome bound with ABCF protein New1
5DGF 2016-12-14 3.3 Complex of yeast 80S ribosome with hypusine-containing/non-modified eIF5A and/or a peptidyl-tRNA analog
4DDG 2012-02-22 3.3 Crystal structure of human OTUB1/UbcH5b~Ub/Ub
6RI5 2019-06-26 3.3 Cryo-EM structures of Lsg1-TAP pre-60S ribosomal particles
6MSE 2018-11-21 3.3 Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome
5M1J 2017-01-18 3.3 Nonstop ribosomal complex bound with Dom34 and Hbs1
5NDV 2017-12-13 3.3 Crystal structure of Paromomycin bound to the yeast 80S ribosome
5AN9 2015-10-21 3.3 Mechanism of eIF6 release from the nascent 60S ribosomal subunit
5TGA 2016-11-23 3.3 Crystal structure of the S.cerevisiae 80S ribosome in complex with the A-site bound aminoacyl-tRNA analog ACCA-Pro
5T62 2017-02-08 3.3 Nmd3 is a structural mimic of eIF5A, and activates the cpGTPase Lsg1 during 60S ribosome biogenesis: 60S-Nmd3-Tif6-Lsg1 Complex
6PX1 2019-08-28 3.3 Set2 bound to nucleosome
3JVZ 2010-01-12 3.3 E2~Ubiquitin-HECT
6QKL 2019-03-20 3.3 Mechanism of eIF6 release from the nascent 60S ribosomal subunit
4U53 2014-10-22 3.3 Crystal structure of Deoxynivalenol bound to the yeast 80S ribosome
5JTV 2016-10-12 3.31 USP7CD-UBL45 in complex with Ubiquitin
5JTJ 2016-08-10 3.32 USP7CD-CTP in complex with Ubiquitin
2DX5 2006-10-10 3.35 The complex structure between the mouse EAP45-GLUE domain and ubiquitin
5CVN 2015-10-07 3.36 WDR48 (2-580):USP46~ubiquitin ternary complex
6VEN 2020-01-15 3.37 Yeast COMPASS in complex with a ubiquitinated nucleosome
5AIT 2015-07-08 3.4 A complex of of RNF4-RING domain, UbeV2, Ubc13-Ub (isopeptide crosslink)
6HD7 2018-12-19 3.4 Cryo-EM structure of the ribosome-NatA complex
4P4H 2014-07-30 3.4 Caught-in-action signaling complex of RIG-I 2CARD domain and MAVS CARD domain
3J7Q 2014-09-03 3.4 Structure of the idle mammalian ribosome-Sec61 complex
5AF6 2015-03-25 3.4 Structure of Lys33-linked diUb bound to Trabid NZF1
6R87 2019-06-26 3.4 Yeast Vms1 (Q295L)-60S ribosomal subunit complex (pre-state without Arb1)
5OBM 2017-12-13 3.4 Crystal structure of Gentamicin bound to the yeast 80S ribosome
6R86 2019-07-31 3.4 Yeast Vms1-60S ribosomal subunit complex (post-state)
6OLG 2019-06-19 3.4 Human ribosome nascent chain complex stalled by a drug-like small molecule (CDH1_RNC with PP tRNA)
3OJ4 2010-12-08 3.4 Crystal structure of the A20 ZnF4, ubiquitin and UbcH5A complex
5FCI 2016-05-11 3.4 Structure of the vacant uL3 W255C mutant 80S yeast ribosome
3J7O 2014-09-03 3.4 Structure of the mammalian 60S ribosomal subunit
6QT0 2019-06-26 3.4 Cryo-EM structures of Lsg1-TAP pre-60S ribosomal particles
5APO 2015-12-16 3.41 Structure of the yeast 60S ribosomal subunit in complex with Arx1, Alb1 and C-terminally tagged Rei1
5VNZ 2017-12-06 3.41 Structure of a TRAF6-Ubc13~Ub complex
5DGE 2017-01-25 3.45 Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
4U56 2014-10-22 3.45 Crystal structure of Blasticidin S bound to the yeast 80S ribosome
3JAM 2015-08-12 3.46 CryoEM structure of 40S-eIF1A-eIF1 complex from yeast
5EDV 2016-01-20 3.48 Structure of the HOIP-RBR/UbcH5B~ubiquitin transfer complex
5H7S 2017-11-29 3.49 Structural basis of the flanking zinc-finger motifs crucial for the E3 ligase activity of the LNX1 RING domain
5AJ0 2015-05-20 3.5 Cryo electron microscopy of actively translating human polysomes (POST state).
3J7P 2014-09-03 3.5 Structure of the 80S mammalian ribosome bound to eEF2
6O96 2019-04-24 3.5 Dot1L bound to the H2BK120 Ubiquitinated nucleosome
6MSG 2018-11-21 3.5 Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome
6OLI 2019-06-19 3.5 Structure of human ribosome nascent chain complex selectively stalled by a drug-like small molecule (USO1-RNC)
5TGM 2017-01-18 3.5 Crystal structure of the S.cerevisiae 80S ribosome in complex with the A-site bound aminoacyl-tRNA analog ACCA-Pro
6QTZ 2019-06-26 3.5 Cryo-EM structures of Lsg1-TAP pre-60S ribosomal particles
6H4H 2019-03-27 3.5 Usp28 catalytic domain variant E593D in complex with UbPA
6N8O 2019-03-13 3.5 Cryo-EM structure of Rpl10-inserted (RI) pre-60S ribosomal subunit
6G5I 2018-06-06 3.5 Cryo-EM structure of a late human pre-40S ribosomal subunit - State R
5JUP 2016-10-05 3.5 Saccharomyces cerevisiae 80S ribosome bound with elongation factor eEF2-GDP-sordarin and Taura Syndrome Virus IRES, Structure II (mid-rotated 40S subunit)
6FYX 2018-12-05 3.5 Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain (model C1)
6N8M 2019-03-13 3.5 Cryo-EM structure of pre-Lsg1 (PL) pre-60S ribosomal subunit
6UH5 2019-11-20 3.5 Structural basis of COMPASS eCM recognition of the H2Bub nucleosome
2AYO 2005-10-18 3.5 Structure of USP14 bound to ubquitin aldehyde
5MEI 2017-06-28 3.5 Crystal structure of Agelastatin A bound to the 80S ribosome
5KHY 2016-09-14 3.5 Crystal structure of oxime-linked K6 diubiquitin
5TTE 2017-08-23 3.5 Crystal Structure of an RBR E3 ubiquitin ligase in complex with an E2-Ub thioester intermediate mimic
4V8P 2014-07-09 3.52 T.thermophila 60S ribosomal subunit in complex with initiation factor 6.
6NQA 2019-02-20 3.54 Active state Dot1L bound to the H2B-Ubiquitinated nucleosome, 1-to-1 complex
6EML 2017-11-29 3.6 Cryo-EM structure of a late pre-40S ribosomal subunit from Saccharomyces cerevisiae
5LKS 2017-04-26 3.6 Structure-function insights reveal the human ribosome as a cancer target for antibiotics
5T2C 2017-01-25 3.6 CryoEM structure of the human ribosome at 3.6 Angstrom resolution
6UZ7 2020-01-15 3.6 K.lactis 80S ribosome with p/PE tRNA and eIF5B
6T9L 2020-01-29 3.6 SAGA DUB module bound to a ubiqitinated nucleosome
4JIO 2013-06-19 3.6 Bro1 V domain and ubiquitin
5IT7 2016-05-18 3.6 Structure of the Kluyveromyces lactis 80S ribosome in complex with the cricket paralysis virus IRES and eEF2
6G18 2018-06-06 3.6 Cryo-EM structure of a late human pre-40S ribosomal subunit - State C
5OHN 2017-09-20 3.6 Crystal structure of USP30 in covalent complex with ubiquitin propargylamide (low resolution)
4UG0 2015-06-10 3.6 STRUCTURE OF THE HUMAN 80S RIBOSOME
4U4O 2014-10-22 3.6 Crystal structure of Geneticin bound to the yeast 80S ribosome
6R84 2019-06-26 3.6 Yeast Vms1 (Q295L)-60S ribosomal subunit complex (pre-state with Arb1)
6G5H 2018-06-06 3.6 Cryo-EM structure of a late human pre-40S ribosomal subunit - Mature
4UF6 2015-03-04 3.69 UCH-L5 in complex with ubiquitin-propargyl bound to an activating fragment of INO80G
6TTU 2020-02-12 3.7 Ubiquitin Ligation to substrate by a cullin-RING E3 ligase at 3.7A resolution: NEDD8-CUL1-RBX1 N98R-SKP1-monomeric b-TRCP1dD-IkBa-UB~UBE2D2
4NQK 2014-03-05 3.7 Structure of an Ubiquitin complex
5NDW 2017-12-13 3.7 Crystal structure of aminoglycoside TC007 bound to the yeast 80S ribosome
6OM7 2019-06-19 3.7 Human ribosome nascent chain complex (PCSK9-RNC) stalled by a drug-like small molecule with AA and PE tRNAs
5NDG 2017-12-13 3.7 Crystal structure of geneticin (G418) bound to the yeast 80S ribosome
3J80 2014-11-05 3.75 CryoEM structure of 40S-eIF1-eIF1A preinitiation complex
6DJW 2018-07-04 3.8 Crystal Structure of pParkin (REP and RING2 deleted)-pUb-UbcH7 complex
6RBE 2019-06-26 3.8 State 2 of yeast Tsr1-TAP Rps20-Deltaloop pre-40S particles
5IT9 2016-05-18 3.8 Structure of the yeast Kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus IRES.
6NZO 2019-08-28 3.8 Set2 bound to nucleosome
5MC6 2017-01-18 3.8 Cryo-EM structure of a native ribosome-Ski2-Ski3-Ski8 complex from S. cerevisiae
4DDI 2012-02-22 3.8 Crystal structure of human OTUB1/UbcH5b~Ub/Ub
6N8N 2019-03-13 3.8 Cryo-EM structure of Lsg1-engaged (LE) pre-60S ribosomal subunit
6TNF 2020-02-19 3.8 Structure of monoubiquitinated FANCD2 in complex with FANCI and DNA
5OHM 2017-10-04 3.8 K33-specific affimer bound to K33 diUb
4ZUX 2016-02-24 3.82 SAGA DUB module Ubp8/Sgf11/Sus1/Sgf73 bound to ubiqitinated nucleosome
5CVO 2015-10-07 3.88 WDR48:USP46~ubiquitin ternary complex
5GAK 2016-02-24 3.88 Yeast 60S ribosomal subunit with A-site tRNA, P-site tRNA and eIF-5A
5A2Q 2015-07-15 3.9 Structure of the HCV IRES bound to the human ribosome
6OLF 2019-06-19 3.9 Human ribosome nascent chain complex (CDH1-RNC) stalled by a drug-like molecule with AA and PE tRNAs
6IP5 2019-05-29 3.9 Cryo-EM structure of the CMV-stalled human 80S ribosome (Structure ii)
5VO0 2017-12-06 3.9 Structure of a TRAF6-Ubc13~Ub complex
5FLX 2015-12-23 3.9 Mammalian 40S HCV-IRES complex
6GQB 2018-07-11 3.9 Cryo-EM reconstruction of yeast 80S ribosome in complex with mRNA, tRNA and eEF2 (GDP+AlF4/sordarin)
6OA9 2019-07-03 3.9 Cdc48-Npl4 complex processing poly-ubiquitinated substrate in the presence of ATP
6IP8 2019-05-29 3.9 Cryo-EM structure of the HCV IRES dependently initiated CMV-stalled 80S ribosome (Structure iv)
6OLZ 2019-06-19 3.9 Human ribosome nascent chain complex (PCSK9-RNC) stalled by a drug-like molecule with PP tRNA
3J7R 2014-09-03 3.9 Structure of the translating mammalian ribosome-Sec61 complex
5APN 2015-12-16 3.91 Structure of the yeast 60S ribosomal subunit in complex with Arx1, Alb1 and N-terminally tagged Rei1
5JUU 2016-10-05 4.0 Saccharomyces cerevisiae 80S ribosome bound with elongation factor eEF2-GDP-sordarin and Taura Syndrome Virus IRES, Structure V (least rotated 40S subunit)
5JUO 2016-10-05 4.0 Saccharomyces cerevisiae 80S ribosome bound with elongation factor eEF2-GDP-sordarin and Taura Syndrome Virus IRES, Structure I (fully rotated 40S subunit)
6T83 2019-12-25 4.0 Structure of yeast disome (di-ribosome) stalled on poly(A) tract.
6GQV 2018-07-11 4.0 Cryo-EM recosntruction of yeast 80S ribosome in complex with mRNA, tRNA and eEF2 (GMPPCP)
3J81 2014-11-05 4.0 CryoEM structure of a partial yeast 48S preinitiation complex
6KIV 2019-09-11 4.0 Cryo-EM structure of human MLL1-ubNCP complex (4.0 angstrom)
5JUT 2016-10-05 4.0 Saccharomyces cerevisiae 80S ribosome bound with elongation factor eEF2-GDP-sordarin and Taura Syndrome Virus IRES, Structure IV (almost non-rotated 40S subunit)
6KIW 2019-09-11 4.0 Cryo-EM structure of human MLL3-ubNCP complex (4.0 angstrom)
6OAA 2019-07-03 4.1 Cdc48-Npl4 complex processing poly-ubiquitinated substrate in the presence of ADP-BeFx, state 1
6PX3 2019-08-28 4.1 Set2 bound to nucleosome
5ANB 2015-10-21 4.1 Mechanism of eIF6 release from the nascent 60S ribosomal subunit
6J99 2019-02-27 4.1 Cryo-EM structure of human DOT1L in complex with an H2B-monoubiquitinated nucleosome
6G51 2018-06-06 4.1 Cryo-EM structure of a late human pre-40S ribosomal subunit - State D
6EF3 2018-10-17 4.17 Yeast 26S proteasome bound to ubiquitinated substrate (4D motor state)
5T6R 2017-02-08 4.2 Nmd3 is a structural mimic of eIF5A, and activates the cpGTPase Lsg1 during 60S ribosome biogenesis: 60S-Nmd3 Complex
5JUS 2016-10-05 4.2 Saccharomyces cerevisiae 80S ribosome bound with elongation factor eEF2-GDP-sordarin and Taura Syndrome Virus IRES, Structure III (mid-rotated 40S subunit)
5ANC 2015-10-21 4.2 Mechanism of eIF6 release from the nascent 60S ribosomal subunit
4V8Y 2014-07-09 4.3 Cryo-EM reconstruction of the 80S-eIF5B-Met-itRNAMet Eukaryotic Translation Initiation Complex
5GJQ 2016-08-17 4.35 Structure of the human 26S proteasome bound to USP14-UbAl
6GQ1 2018-07-11 4.4 Cryo-EM reconstruction of yeast 80S ribosome in complex with mRNA, tRNA and eEF2 (GMPPCP/sordarin)
6FTX 2018-08-08 4.5 Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome
6IP6 2019-05-29 4.5 Cryo-EM structure of the CMV-stalled human 80S ribosome with HCV IRES (Structure iii)
6G53 2018-06-06 4.5 Cryo-EM structure of a late human pre-40S ribosomal subunit - State E
5KGF 2016-07-27 4.54 Structural model of 53BP1 bound to a ubiquitylated and methylated nucleosome, at 4.5 A resolution
6DJX 2018-07-04 4.8 Crystal Structure of pParkin-pUb-UbcH7 complex
3JAP 2015-08-12 4.9 Structure of a partial yeast 48S preinitiation complex in closed conformation
4V6X 2014-07-09 5.0 Structure of the human 80S ribosome
6GSM 2019-07-31 5.15 Structure of a partial yeast 48S preinitiation complex in open conformation
6I7O 2019-01-16 5.3 The structure of a di-ribosome (disome) as a unit for RQC and NGD quality control pathways recognition.
4V8M 2014-07-09 5.57 High-resolution cryo-electron microscopy structure of the Trypanosoma brucei ribosome
6GSN 2019-06-26 5.75 Structure of a partial yeast 48S preinitiation complex in closed conformation
4V6W 2014-07-09 6.0 Structure of the D. melanogaster 80S ribosome
3JAQ 2015-08-12 6.0 Structure of a partial yeast 48S preinitiation complex in open conformation
3J6X 2014-06-11 6.1 S. cerevisiae 80S ribosome bound with Taura syndrome virus (TSV) IRES, 5 degree rotation (Class II)
3J6Y 2014-06-11 6.1 S. cerevisiae 80S ribosome bound with Taura syndrome virus (TSV) IRES, 2 degree rotation (Class I)
3J77 2014-08-06 6.2 Structures of yeast 80S ribosome-tRNA complexes in the rotated and non-rotated conformations (Class II - rotated ribosome with 1 tRNA)
3J78 2014-08-06 6.3 Structures of yeast 80S ribosome-tRNA complexes in the rotated and non-rotated conformations (Class I - non-rotated ribosome with 2 tRNAs)
6FEC 2018-03-14 6.3 Human cap-dependent 48S pre-initiation complex
5L9U 2016-09-14 6.4 Model of human Anaphase-promoting complex/Cyclosome (APC/C-CDH1) with a cross linked Ubiquitin variant-substrate-UBE2C (UBCH10) complex representing key features of multiubiquitination
5L9T 2016-10-26 6.4 Model of human Anaphase-promoting complex/Cyclosome (APC/C-CDH1) with E2 UBE2S poised for polyubiquitination where UBE2S, APC2, and APC11 are modeled into low resolution density
4V8Z 2014-07-09 6.6 Cryo-EM reconstruction of the 80S-eIF5B-Met-itRNAMet Eukaryotic Translation Initiation Complex
4ADX 2012-02-08 6.6 The Cryo-EM Structure of the Archaeal 50S Ribosomal Subunit in Complex with Initiation Factor 6
6JMA 2019-05-15 6.8 cryo-EM structure of DOT1L bound to H2B ubiquitinated nucleosome
4V8T 2014-07-09 8.1 Cryo-EM Structure of the 60S Ribosomal Subunit in Complex with Arx1 and Rei1
4WHV 2015-09-30 8.3 E3 ubiquitin-protein ligase RNF8 in complex with Ubiquitin-conjugating enzyme E2 N and Polyubiquitin-B
5WYJ 2017-03-29 8.7 Cryo-EM structure of the 90S small subunit pre-ribosome (Dhr1-depleted, Enp1-TAP, state 1)
4V6I 2014-07-09 8.8 Localization of the small subunit ribosomal proteins into a 6.1 A cryo-EM map of Saccharomyces cerevisiae translating 80S ribosome
5A5B 2015-07-22 9.5 Structure of the 26S proteasome-Ubp6 complex

Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
100.0 E3 ubiquitin-protein ligase RSP5 P39940 RSP5_YEAST
100.0 A Ubiquitin-binding protein CUE2 P36075 CUE2_YEAST
100.0 B Ubiquitin-binding protein CUE2 P0CH06 RL401_SCHPO
100.0 B Ubiquitin-binding protein CUE2 P0CH07 RL402_SCHPO
100.0 B Ubiquitin-binding protein CUE2 P0CH08 RL40A_YEAST
100.0 B Ubiquitin-binding protein CUE2 P0CH09 RL40B_YEAST
100.0 B Ubiquitin-binding protein CUE2 P40909 RL40_CRYNJ
100.0 B Ubiquitin-binding protein CUE2 P0CG73 UBI1P_CANAX
100.0 B Ubiquitin-binding protein CUE2 P0CG74 UBI4P_CANAX
100.0 B Ubiquitin-binding protein CUE2 P0CG75 UBI4P_KLULA
100.0 B Ubiquitin-binding protein CUE2 P0CG72 UBI4P_SCHPO
100.0 B Ubiquitin-binding protein CUE2 P0CG63 UBI4P_YEAST
98.7 B Ubiquitin-binding protein CUE2 P19848 UBIQ_COPCO
98.7 B Ubiquitin-binding protein CUE2 P0C224 RL40_NEUCR
98.7 B Ubiquitin-binding protein CUE2 P0CG70 UBI4P_NEUCR
97.4 B Ubiquitin-binding protein CUE2 P59271 R27AA_ARATH
97.4 B Ubiquitin-binding protein CUE2 B9DHA6 RL40A_ARATH
97.4 B Ubiquitin-binding protein CUE2 P0CH34 RL40A_ORYSJ
97.4 B Ubiquitin-binding protein CUE2 Q42202 RL40B_ARATH
97.4 B Ubiquitin-binding protein CUE2 P0CH35 RL40B_ORYSJ
97.4 B Ubiquitin-binding protein CUE2 P51423 RL40_BRARP
97.4 B Ubiquitin-binding protein CUE2 P49636 RL40_NICSY
97.4 B Ubiquitin-binding protein CUE2 P62980 RS27A_SOLLC
97.4 B Ubiquitin-binding protein CUE2 P62981 RS27A_SOLTU
97.4 B Ubiquitin-binding protein CUE2 Q9SHE7 RUB1_ARATH
97.4 B Ubiquitin-binding protein CUE2 P0C073 RUB1_DESAN
97.4 B Ubiquitin-binding protein CUE2 P0C030 RUB1_ORYSJ
97.4 B Ubiquitin-binding protein CUE2 Q8RUC6 RUB2_ARATH
97.4 B Ubiquitin-binding protein CUE2 P0C031 RUB2_ORYSJ
97.4 B Ubiquitin-binding protein CUE2 P0CG85 UBI1P_NICSY
97.4 B Ubiquitin-binding protein CUE2 P0CH04 UBI1P_PETCR
97.4 B Ubiquitin-binding protein CUE2 P0CH05 UBI2P_PETCR
97.4 B Ubiquitin-binding protein CUE2 P0CG84 UBI4P_NICSY
97.4 B Ubiquitin-binding protein CUE2 P69309 UBIQP_AVEFA
97.4 B Ubiquitin-binding protein CUE2 P0CG83 UBIQP_HORVU
97.4 B Ubiquitin-binding protein CUE2 P69315 UBIQP_LINUS
97.4 B Ubiquitin-binding protein CUE2 P69322 UBIQP_PEA
97.4 B Ubiquitin-binding protein CUE2 P69325 UBIQP_SOYBN
97.4 B Ubiquitin-binding protein CUE2 P69310 UBIQ_AVESA
97.4 B Ubiquitin-binding protein CUE2 P69313 UBIQ_HELAN
97.4 B Ubiquitin-binding protein CUE2 P69317 UBIQ_LUPPO
97.4 B Ubiquitin-binding protein CUE2 P69326 UBIQ_WHEAT
97.4 B Ubiquitin-binding protein CUE2 Q8H159 UBQ10_ARATH
97.4 B Ubiquitin-binding protein CUE2 P0CH33 UBQ11_ARATH
97.4 B Ubiquitin-binding protein CUE2 Q3E7T8 UBQ14_ARATH
97.4 B Ubiquitin-binding protein CUE2 Q1EC66 UBQ3_ARATH
97.4 B Ubiquitin-binding protein CUE2 Q58G87 UBQ3_ORYSJ
97.4 B Ubiquitin-binding protein CUE2 P0CH32 UBQ4_ARATH
100.0 B Ubiquitin-binding protein CUE2 P69061 RS27A_KLULA
100.0 B Ubiquitin-binding protein CUE2 P05759 RS31_YEAST
97.4 B Ubiquitin-binding protein CUE2 P42740 UBIQP_AGLNE
96.1 B Ubiquitin-binding protein CUE2 P42739 UBIQP_ACEPE
96.1 B Ubiquitin-binding protein CUE2 Q3E7K8 UBQ12_ARATH
96.1 B Ubiquitin-binding protein CUE2 P0CH11 RL401_CHLRE
96.1 B Ubiquitin-binding protein CUE2 P0CH10 RL403_CHLRE
96.1 B Ubiquitin-binding protein CUE2 P49632 RL40_CAEEL
96.1 B Ubiquitin-binding protein CUE2 P0CG71 UBIQ1_CAEEL
96.1 B Ubiquitin-binding protein CUE2 P59669 UBIQP_GEOCY
94.7 B Ubiquitin-binding protein CUE2 Q9FHQ6 UBQ9_ARATH
96.1 B Ubiquitin-binding protein CUE2 P49633 RL40_ACACA
98.7 B Ubiquitin-binding protein CUE2 P14799 RS27A_NEUCR
96.1 B Ubiquitin-binding protein CUE2 P63048 RL40_BOVIN
96.1 B Ubiquitin-binding protein CUE2 P63050 RL40_CANLF
96.1 B Ubiquitin-binding protein CUE2 P18101 RL40_DROME
96.1 B Ubiquitin-binding protein CUE2 P63052 RL40_FELCA
96.1 B Ubiquitin-binding protein CUE2 P62987 RL40_HUMAN
96.1 B Ubiquitin-binding protein CUE2 P0C273 RL40_MACFA
96.1 B Ubiquitin-binding protein CUE2 P62984 RL40_MOUSE
96.1 B Ubiquitin-binding protein CUE2 P68205 RL40_OPHHA
96.1 B Ubiquitin-binding protein CUE2 P63053 RL40_PIG
96.1 B Ubiquitin-binding protein CUE2 P0C275 RL40_PONPY
96.1 B Ubiquitin-binding protein CUE2 P62986 RL40_RAT
96.1 B Ubiquitin-binding protein CUE2 P0C276 RL40_SHEEP
96.1 B Ubiquitin-binding protein CUE2 P15357 RS27A_DROME
96.1 B Ubiquitin-binding protein CUE2 P29504 RS27A_MANSE
96.1 B Ubiquitin-binding protein CUE2 P68202 RS27A_PLUXY
96.1 B Ubiquitin-binding protein CUE2 P68203 RS27A_SPOFR
96.1 B Ubiquitin-binding protein CUE2 P0CG53 UBB_BOVIN
96.1 B Ubiquitin-binding protein CUE2 P0CG54 UBB_CAVPO
96.1 B Ubiquitin-binding protein CUE2 P0CG62 UBB_CHICK
96.1 B Ubiquitin-binding protein CUE2 P0CG67 UBB_GORGO
96.1 B Ubiquitin-binding protein CUE2 Q8MKD1 UBB_HORSE
96.1 B Ubiquitin-binding protein CUE2 P0CG47 UBB_HUMAN
96.1 B Ubiquitin-binding protein CUE2 P0CG49 UBB_MOUSE
96.1 B Ubiquitin-binding protein CUE2 P0CG65 UBB_PANTR
96.1 B Ubiquitin-binding protein CUE2 P0CG60 UBB_PONPY
96.1 B Ubiquitin-binding protein CUE2 P0CG51 UBB_RAT
96.1 B Ubiquitin-binding protein CUE2 P0CG55 UBB_SHEEP
96.1 B Ubiquitin-binding protein CUE2 P0CH28 UBC_BOVIN
96.1 B Ubiquitin-binding protein CUE2 P0CG66 UBC_GORGO
96.1 B Ubiquitin-binding protein CUE2 P0CG48 UBC_HUMAN
96.1 B Ubiquitin-binding protein CUE2 P0CG50 UBC_MOUSE
96.1 B Ubiquitin-binding protein CUE2 P0CG64 UBC_PANTR
96.1 B Ubiquitin-binding protein CUE2 P0CG68 UBC_PIG
96.1 B Ubiquitin-binding protein CUE2 P0CG61 UBC_PONPY
96.1 B Ubiquitin-binding protein CUE2 Q63429 UBC_RAT
96.1 B Ubiquitin-binding protein CUE2 P62976 UBIQP_CRIGR
96.1 B Ubiquitin-binding protein CUE2 P0CG69 UBIQP_DROME
96.1 B Ubiquitin-binding protein CUE2 P62972 UBIQP_XENLA
96.1 B Ubiquitin-binding protein CUE2 Q865C5 UBIQ_CAMDR
96.1 B Ubiquitin-binding protein CUE2 P68197 UBIQ_CERCA
96.1 B Ubiquitin-binding protein CUE2 P62975 UBIQ_RABIT
94.7 B Ubiquitin-binding protein CUE2 P33190 RL40_TETPY
94.7 B Ubiquitin-binding protein CUE2 P0DJ25 RL40_TETTS
94.7 B Ubiquitin-binding protein CUE2 P0C032 RUB3_ORYSJ
94.7 B Ubiquitin-binding protein CUE2 P23324 UBIQP_EUPEU
94.7 B Ubiquitin-binding protein CUE2 P0CG82 UBIQP_TETPY
94.7 B Ubiquitin-binding protein CUE2 P0CH27 RL402_TRYCR
94.7 B Ubiquitin-binding protein CUE2 P46575 RL40_EIMBO
94.7 B Ubiquitin-binding protein CUE2 P14795 RL40_TRYCR
94.7 B Ubiquitin-binding protein CUE2 P14794 RL40_DICDI
94.7 B Ubiquitin-binding protein CUE2 P0CG76 UBIQA_DICDI
94.7 B Ubiquitin-binding protein CUE2 P0CG77 UBIQD_DICDI
94.7 B Ubiquitin-binding protein CUE2 P0CG78 UBIQF_DICDI
94.7 B Ubiquitin-binding protein CUE2 P0CG79 UBIQG_DICDI
94.7 B Ubiquitin-binding protein CUE2 P0CG81 UBIQH_DICDI
94.7 B Ubiquitin-binding protein CUE2 P0CG80 UBIQI_DICDI
94.7 B Ubiquitin-binding protein CUE2 P0CG88 UBIQJ_DICDI
94.7 B Ubiquitin-binding protein CUE2 P22589 UBIQP_PHYIN
94.7 B Ubiquitin-binding protein CUE2 P23398 UBIQP_STRPU
94.7 B Ubiquitin-binding protein CUE2 Q8SWD4 UBIQ_ENCCU
96.0 B Ubiquitin-binding protein CUE2 P62992 RS27A_BOVIN
96.0 B Ubiquitin-binding protein CUE2 P62978 RS27A_CAVPO
96.0 B Ubiquitin-binding protein CUE2 P79781 RS27A_CHICK
96.0 B Ubiquitin-binding protein CUE2 P62979 RS27A_HUMAN
96.0 B Ubiquitin-binding protein CUE2 P68200 RS27A_ICTPU
96.0 B Ubiquitin-binding protein CUE2 P62983 RS27A_MOUSE
96.0 B Ubiquitin-binding protein CUE2 P62982 RS27A_RAT
93.4 B Ubiquitin-binding protein CUE2 P69201 RL40_LEIMA
92.1 B Ubiquitin-binding protein CUE2 P21899 RL40_TRYBB
100.0 B Ubiquitin-binding protein CUE2 P0C016 RS27A_SCHPO
100.0 B Ubiquitin-binding protein CUE2 P0C8R3 RS27B_SCHPO
97.2 B Ubiquitin-binding protein CUE2 Q9ARZ9 R27AA_ORYSJ
97.2 B Ubiquitin-binding protein CUE2 P59232 R27AB_ARATH
97.2 B Ubiquitin-binding protein CUE2 P51431 R27AB_ORYSJ
97.2 B Ubiquitin-binding protein CUE2 P59233 R27AC_ARATH
97.2 B Ubiquitin-binding protein CUE2 P0CG86 RS271_HORVU
97.2 B Ubiquitin-binding protein CUE2 P0CG87 RS272_HORVU
97.2 B Ubiquitin-binding protein CUE2 P47905 RS27A_LUPAL
97.2 B Ubiquitin-binding protein CUE2 P27923 RS27A_MAIZE
93.2 B Ubiquitin-binding protein CUE2 P14797 RS27A_DICDI
90.8 B Ubiquitin-binding protein CUE2 P69200 RL40_LEITA
97.1 B Ubiquitin-binding protein CUE2 P59272 RS27A_DAUCA
90.8 B Ubiquitin-binding protein CUE2 Q39256 UBQ8_ARATH
95.2 B Ubiquitin-binding protein CUE2 P84589 UBIQ_LUMTE
97.5 B Ubiquitin-binding protein CUE2 P31753 RS27A_ASPOF