We report steady-state and time-resolved fluorescence studies with the single tryptophan protein, Staphylococcus aureus A, and several of its site-directed mutants. A couple of these mutants, nuclease-conA and nuclease-conA-S28G (which are hybrid proteins containing a six amino acid beta-turn substitute from concanavalin A), are found to have a much lower thermodynamic stability than the wild type. The thermal transition temperatures for nuclease-conA and S28G are 32.8 and 30.5 degrees C, which are about 20 degrees C lower than the Tm for wild-type nuclease A. These mutant proteins also are denatured by a much lower concentration of the denaturants urea and guanidine hydrochloride. We also show that an unfolding transition in the structure of the nuclease-conA hybrids can be induced by relatively low hydrostatic pressure (approximately 700 bar). The free energy for unfolding of nuclease-conA (and nuclease-conA-S28G) is found to be only 1.4 kcal/mol (and 1.2 kcal/mol) by thermal, urea, guanidine hydrochloride, and pressure unfolding. Time-resolved fluorescence intensity and anisotropy measurements with nuclease-conA-S28G show the temperature-, urea-, and pressure-perturbed states each to have a reduced average intensity decay time and to depolarize with a rotational correlation time of approximately 1.0 ns (as compared to a rotational correlation time of 11 ns for the native form of nuclease-conA-S28G at 20 degrees C). Study holds ProTherm entries: 378, 379, 380, 381, 382 Extra Details: Staphylococcus nuclease; conformational stability; free energy
ID: rayqfKrv3
Submitter: Connie Wang
Submission Date: April 24, 2018, 8:15 p.m.
Version: 1
Number of data points | 15 |
Proteins | Thermonuclease ; Thermonuclease ; Thermonuclease ; Thermonuclease ; Thermonuclease |
Unique complexes | 5 |
Assays/Quantities/Protocols | Experimental Assay: Tm ; Experimental Assay: dHvH ; Derived Quantity: dTm |
Libraries | Mutations for sequence ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWSEDNADSGQ |
Colors: | D | E | R | H | K | S | T | N | Q | A | V | I | L | M | F | Y | W | C | G | P |
---|
Percent Identity | Matching Chains | Protein | Accession | Entry Name |
---|---|---|---|---|
100.0 | Thermonuclease | P00644 | NUC_STAAU | |
99.3 | Thermonuclease | Q5HHM4 | NUC_STAAC | |
99.1 | Thermonuclease | Q99VJ0 | NUC_STAAM | |
99.1 | Thermonuclease | Q7A6P2 | NUC_STAAN | |
99.3 | Thermonuclease | Q6GB41 | NUC_STAAS | |
99.3 | Thermonuclease | Q8NXI6 | NUC_STAAW | |
99.3 | Thermonuclease | Q6GIK1 | NUC_STAAR |