Comparative thermodynamic study of pepsinogen and pepsin structure.


Abstract

Study holds ProTherm entries: 11204, 11205, 11206, 11207, 11208, 11209, 11210, 11211, 11212, 11213, 11214, 11215, 11216, 11217, 11218, 11219, 11220, 11221, 11222, 11223, 11224, 11225, 11226, 11227, 11228 Extra Details: two-state transition; co-operative units; domains

Submission Details

ID: mnnoDmqN3

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:41 p.m.

Version: 1

Publication Details
Privalov PL;Mateo PL;Khechinashvili NN;Stepanov VM;Revina LP,J. Mol. Biol. (1981) Comparative thermodynamic study of pepsinogen and pepsin structure. PMID:6799654
Additional Information

Number of data points 73
Proteins Pepsin A ; Gastricsin ; Pepsin A ; Pepsin A
Unique complexes 2
Assays/Quantities/Protocols Experimental Assay: dHcal pH:7.5, ionic:NaCl: 100 mM, buffers:sodium phosphate: 5 mM ; Experimental Assay: Tm pH:7.5, ionic:NaCl: 100 mM, buffers:sodium phosphate: 5 mM ; Experimental Assay: dHvH pH:7.5, ionic:NaCl: 100 mM, buffers:sodium phosphate: 5 mM ; Experimental Assay: dHcal pH:7.5, buffers:sodium phosphate: 5 mM, ionic:: ; Experimental Assay: Tm pH:7.5, buffers:sodium phosphate: 5 mM, ionic:: ; Experimental Assay: dHvH pH:7.5, buffers:sodium phosphate: 5 mM, ionic:: ; Experimental Assay: dHcal ionic:NaCl: 10 mM, buffers:sodium phosphate: 5 mM, pH:7.1 ; Experimental Assay: Tm ionic:NaCl: 10 mM, buffers:sodium phosphate: 5 mM, pH:7.1 ; Experimental Assay: dHvH ionic:NaCl: 10 mM, buffers:sodium phosphate: 5 mM, pH:7.1 ; Experimental Assay: dHcal ionic:NaCl: 100 mM, buffers:sodium cacodylate: 5 mM, pH:5.9 ; Experimental Assay: Tm ionic:NaCl: 100 mM, buffers:sodium cacodylate: 5 mM, pH:5.9 ; Experimental Assay: dHvH ionic:NaCl: 100 mM, buffers:sodium cacodylate: 5 mM, pH:5.9 ; Experimental Assay: dHcal ionic:: , buffers:sodium cacodylate: 5 mM, pH:5.9 ; Experimental Assay: Tm ionic:: , buffers:sodium cacodylate: 5 mM, pH:5.9 ; Experimental Assay: dHvH ionic:: , buffers:sodium cacodylate: 5 mM, pH:5.9 ; Experimental Assay: dHcal buffers:sodium phosphate: 5 mM, ionic:: , pH:6.5 ; Experimental Assay: Tm buffers:sodium phosphate: 5 mM, ionic:: , pH:6.5 ; Experimental Assay: dHvH buffers:sodium phosphate: 5 mM, ionic:: , pH:6.5 ; Experimental Assay: dHcal pH:7.1, ionic:NaCl: 100 mM, buffers:sodium phosphate: 5 mM ; Experimental Assay: Tm pH:7.1, ionic:NaCl: 100 mM, buffers:sodium phosphate: 5 mM ; Experimental Assay: dHvH buffers:sodium phosphate: 5 mM, ionic:NaCl: 100 mM, pH:7.1 ; Experimental Assay: dHcal buffers:sodium phosphate: 5 mM, ionic:: , pH:8.0 ; Experimental Assay: Tm buffers:sodium phosphate: 5 mM, ionic:: , pH:8.0 ; Experimental Assay: dHvH buffers:sodium phosphate: 5 mM, ionic:: , pH:8.0 ; Experimental Assay: dHcal pH:7.1, buffers:sodium phosphate: 5 mM, ionic:: ; Experimental Assay: Tm pH:7.1, buffers:sodium phosphate: 5 mM, ionic:: ; Experimental Assay: dHvH ionic:: , buffers:sodium phosphate: 5 mM, pH:7.1 ; Experimental Assay: dHcal ionic:NaCl: 100 mM, buffers:sodium phosphate: 5 mM, pH:6.5 ; Experimental Assay: Tm ionic:NaCl: 100 mM, buffers:sodium phosphate: 5 mM, pH:6.5 ; Experimental Assay: dHvH ionic:NaCl: 100 mM, buffers:sodium phosphate: 5 mM, pH:6.5 ; Experimental Assay: dHcal pH:6.0, ionic:: , buffers:sodium cacodylate: 5 mM ; Experimental Assay: Tm pH:6.0, ionic:: , buffers:sodium cacodylate: 5 mM ; Experimental Assay: dHvH pH:6.0, ionic:: , buffers:sodium cacodylate: 5 mM
Libraries Mutations for sequence IGDEPLENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFEATSQELSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDDSGSVVLLGGIDSSYYTGSLNWVPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENSDGEMVISCSSIASLPDIVFTINGVQYPLSPSAYILQDDDSCTSGFEGMDVPTSSGELWILGDVFIRQYYTVFDRANNKVGLAPVA ; Mutations for sequence LVKVPLVRKKSLRQNLIKDGKLKDFLKTHKHNPASKYFPEAAALIGDEPLENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFEATSQELSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDDSGSVVLLGGIDSSYYTGSLNWVPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENSDGEMVISCSSIDSLPDIVFTIDGVQYPLSPSAYILQDDDSCTSGFEGMDVPTSSGELWILGDVFIRQYYTVFDRANNKVGLAPVA
Sequence Assay Result Units