Coupling protein stability and protein function in Escherichia coli CspA.

Abstract

CspA is a small protein that binds single-stranded RNA and DNA. The binding site of CspA consists of a cluster of aromatic amino acids, which form an unusually large nonpolar patch on the surface of the protein. Because nonpolar residues are generally found in the interiors of proteins, this cluster may have evolved to bind nucleic acids at the expense of protein stability. Study holds ProTherm entries: 3612, 3613, 3614, 3615, 3616, 3617, 3618, 3619, 3620, 3621, 3622, 3623, 3624, 3625, 3626, 3627 Extra Details: beta sheet; protein folding; aromatic interactions;,ssDNA and ssRNA binding

Submission Details

ID: jUzJ3DbT3

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:22 p.m.

Version: 1

Publication Details
Hillier BJ;Rodriguez HM;Gregoret LM,Fold Des (1998) Coupling protein stability and protein function in Escherichia coli CspA. PMID:9565753
Additional Information

Study Summary

Number of data points 62
Proteins Cold shock protein CspA ; Cold shock protein CspA
Unique complexes 15
Assays/Quantities/Protocols Experimental Assay: Cm temp:10.0 C ; Experimental Assay: m temp:10.0 C ; Experimental Assay: dG_H2O temp:10.0 C ; Experimental Assay: Cm temp:25.0 C ; Experimental Assay: m temp:25.0 C ; Experimental Assay: dG_H2O temp:25.0 C ; Derived Quantity: ddG_H2O temp:10.0 C ; Derived Quantity: ddG_H2O temp:25.0 C
Libraries Mutations for sequence SGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
100.0 Cold shock protein CspA P0A9Y1 CSPA_ECO57
100.0 Cold shock protein CspA P0A9Y0 CSPA_ECOL6
100.0 Cold shock protein CspA P0A9X9 CSPA_ECOLI
100.0 Cold shock protein CspA Q46664 CSPA_KLEAK
100.0 Cold shock protein CspA P0A9Y5 CSPA_SALEN
100.0 Cold shock protein CspA P0A9Y3 CSPA_SALTI
100.0 Cold shock protein CspA P0A9Y2 CSPA_SALTY
100.0 Cold shock protein CspA P0A9Y4 CSPA_SHIFL
100.0 Cold shock protein CspA Q46051 CSPA_CITFR
100.0 Cold shock protein CspA Q56178 CSPA_SALVI
100.0 Cold shock protein CspA Q53816 CSPA_SHIBO