Earlier studies of the unfolding pathway of native bovine pancreatic ribonuclease A (using dithiothreitol as the reducing agent) revealed that the three-disulfide species lacking the disulfide bond between cysteine 65 and cysteine 72 is the most highly populated intermediate [Rothwarf & Scheraga (1991) J. Am. Chem. Soc. 113, 6293-6294]. This unfolding intermediate is referred to as des-[65-72]-RNase A. In order to determine the role of des-[65-72]-RNase A, i.e. of the 65-72 disulfide bond, in the structural folding/unfolding processes of RNase A, the stability and structure of this unfolding intermediate were determined by examining its thermal transition curve and by using two- and three-dimensional homonuclear 1H NMR spectroscopy. The midpoint of the thermal transition of des-[65-72]-RNase A was found to be 17.8 degrees C lower than that of native RNase A. A set of conformations that are consistent with the NMR-derived constraints was obtained by minimizing, first, a variable-target function and, then, the conformational energy. These conformations exhibit a well-defined structure that is very similar to that of native ribonuclease A in regions where the native protein has a regular backbone structure such as a beta-sheet or a helix. Some of the loop regions of the several computed structures exhibit large deviations from each other as well as from native ribonuclease A. However, these results indicate that des-[65-72]-RNase A has a close structural similarity to RNase A in all regions with the only major differences occurring in a loop region comprising residues 60-72. This led to the conclusion that, in reduction pathways that include des-[65-72]-RNase A (at 25 degrees C, pH 8.0), the rate-determining step corresponds to a partial unfolding event in one region of the protein and not to a global conformational unfolding process. The results further suggest that, in the regeneration pathways involving des-[65-72]-RNase A, the loop region from 60 to 72 is the last to fold. Study holds ProTherm entries: 4518 Extra Details: unfolding pathway; disulfide bond; conformational energy;,beta-sheet; helix; rate-determining step
ID: inPmkk9z
Submitter: Connie Wang
Submission Date: April 24, 2018, 8:25 p.m.
Version: 1
| Number of data points | 3 |
| Proteins | Ribonuclease pancreatic ; Ribonuclease pancreatic |
| Unique complexes | 1 |
| Assays/Quantities/Protocols | Experimental Assay: activity ; Experimental Assay: Tm ; Experimental Assay: dHvH |
| Libraries | Mutations for sequence KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV |
| Colors: | D | E | R | H | K | S | T | N | Q | A | V | I | L | M | F | Y | W | C | G | P |
|---|
| Percent Identity | Matching Chains | Protein | Accession | Entry Name |
|---|---|---|---|---|
| 100.0 | Ribonuclease pancreatic | P61824 | RNAS1_BISBI | |
| 100.0 | Ribonuclease pancreatic | P61823 | RNAS1_BOVIN | |
| 96.8 | Ribonuclease pancreatic | P67926 | RNAS1_CAPHI | |
| 96.8 | Ribonuclease pancreatic | P67927 | RNAS1_SHEEP | |
| 95.2 | Ribonuclease pancreatic | P00657 | RNAS1_BUBBU | |
| 96.0 | Ribonuclease pancreatic | P07847 | RNAS1_AEPME | |
| 93.5 | Ribonuclease pancreatic | P07848 | RNAS1_EUDTH | |
| 95.2 | Ribonuclease pancreatic | P00660 | RNAS1_CONTA | |
| 92.7 | Ribonuclease pancreatic | P00668 | RNAS1_ANTAM | |
| 90.3 | Ribonuclease pancreatic | P00662 | RNAS1_GIRCA | |
| 96.0 | Ribonuclease pancreatic | Q29606 | RNAS1_ORYLE |