Packing interactions in the apomyglobin folding intermediate.
Abstract
The contribution of specific packing to the stability of the sperm whale apomyoglobin intermediate has been studied by urea denaturation monitored by circular dichroism and fluorescence. Mutations disrupting native packing sites within the subdomain formed by the A, G and H helices destabilize the intermediate, in contrast to the conclusion drawn from earlier studies of pH-induced unfolding. Based on these results, the intermediate is proposed to be stabilized by both partially formed native-like tertiary, and non-specific hydrophobic interactions forming a subdomain folding intermediate. The results help to explain how the intermediate acquires its structure and stability. Study holds ProTherm entries: 2091, 2092, 2093, 2094, 2095, 2096, 2097, 2098, 2099, 2812, 2813, 2814, 2815, 2816, 2817, 2818, 2819, 2820, 2821, 2822, 2823, 2824, 2825, 2826, 2827, 2828, 2829 Extra Details: the transition is 3-state apomyglobin; specific packing; hydrophobic interactions;,stability; folding
Submission Details
ID: g4EE5Xr7
Submitter: Connie Wang
Submission Date: April 24, 2018, 8:18 p.m.
Version: 1
Publication Details
Kay MS;Baldwin RL,Nat. Struct. Biol. (1996) Packing interactions in the apomyglobin folding intermediate. PMID:8612074Additional Information
Study Summary
| Number of data points | 54 |
| Proteins | Myoglobin ; Myoglobin |
| Unique complexes | 9 |
| Assays/Quantities/Protocols | Experimental Assay: dG ; Derived Quantity: ddG |
| Libraries | Mutations for sequence VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG |
Structure view and single mutant data analysis
Study data
| Colors: | D | E | R | H | K | S | T | N | Q | A | V | I | L | M | F | Y | W | C | G | P |
|---|
Data Distribution
Studies with similar sequences (approximate matches)
Correlation with other assays (exact sequence matches)
Relevant UniProtKB Entries
| Percent Identity | Matching Chains | Protein | Accession | Entry Name |
|---|---|---|---|---|
| 100.0 | Myoglobin | P02185 | MYG_PHYMC | |
| 96.8 | Myoglobin | Q0KIY5 | MYG_KOGBR | |
| 96.8 | Myoglobin | P02184 | MYG_KOGSI | |
| 92.9 | Myoglobin | Q0KIY1 | MYG_BALBO | |
| 92.9 | Myoglobin | Q0KIY2 | MYG_BALED | |
| 92.9 | Myoglobin | P02177 | MYG_ESCRO | |
| 92.2 | Myoglobin | P02178 | MYG_MEGNO | |
| 91.4 | Myoglobin | Q0KIY3 | MYG_PENEL | |
| 91.4 | Myoglobin | P02181 | MYG_INIGE | |
| 92.1 | Myoglobin | P02174 | MYG_GLOME | |
| 90.9 | Myoglobin | P02179 | MYG_BALAC | |
| 91.4 | Myoglobin | P02173 | MYG_ORCOR | |
| 90.8 | Myoglobin | Q0KIY7 | MYG1_STEAT | |
| 90.8 | Myoglobin | P68276 | MYG_DELDE | |
| 90.8 | Myoglobin | P68279 | MYG_TURTR | |
| 90.8 | Myoglobin | P68277 | MYG_PHODA | |
| 90.8 | Myoglobin | P68278 | MYG_PHOPH | |
| 90.3 | Myoglobin | P02180 | MYG_BALPH | |
| 90.1 | Myoglobin | P02183 | MYG_MESCA | |
| 90.1 | Myoglobin | Q0KIY0 | MYG_MESST | |
| 90.1 | Myoglobin | P02182 | MYG_ZIPCA |