Sequence and stability of the goat cytochrome c.


Abstract

We have determined the sequence of mitochondrial cytochrome c (cyt-c) from the goat heart, and it was found to have a unique amino acid sequence among all amino acid sequences of cyt-c reported till date. Its sequence alignment with the bovine cytochrome c (b-cyt-c) led us to conclude that the goat cytochrome c (g-cyt-c) differs in amino acid sequence from b-cyt-c at only one position, i.e., Pro44(bovine) --> Ala44(goat). It has been observed that guanidinium chloride (GdmCl) induces a two-state transition between the native (N) and denatured (D) states of g-cyt-c. This conclusion is reached from the coincidence of GdmCl-induced transition curves monitored by measurements of absorbance at 405, 530 and 695 nm and circular dichroism (CD) at 222, 416 and 405 nm. Analysis of denaturation curves for the Gibbs energy of stabilization suggests that the stability of g-cyt-c is, within experimental errors, identical to that of b-cyt-c. We have also measured the effect of temperature on the equilibrium, N state <--> D state of g-cyt-c in the presence of different GdmCl concentrations. These measurements gave values of transition temperature (T(m)), changes in enthalpy (DeltaH(m)) and heat capacity (DeltaC(p)) of g-cyt-c in the absence of GdmCl, which are compared with those of b-cyt-c. We have used crystal structure coordinates of b-cyt-c to predict the structure and stability of g-cyt-c, which are compared with those of the bovine protein. Study holds ProTherm entries: 25565, 25566, 25567, 25568, 25569, 25570, 25571, 25572, 25573, 25574, 25575, 25576, 25577, 25578, 25579, 25580, 25581, 25582, 25583, 25584, 25585, 25586, 25587, 25588 Extra Details: monited by [theta]222 Folding and stability; Molecular modeling; Goat cytochrome c; Bovine cytochrome c; Circular dichroism

Submission Details

ID: fNkhmM4o

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:55 p.m.

Version: 1

Publication Details
Rahaman H;Khan KA;Hassan I;Wahid M;Singh SB;Singh TP;Moosavi-Movahedi AA;Ahmad F,Biophys. Chem. (2008) Sequence and stability of the goat cytochrome c. PMID:18814948
Additional Information

Number of data points 54
Proteins Mitochondrial cytochrome c
Unique complexes 1
Assays/Quantities/Protocols Experimental Assay: dG_H2O units:kcal/mol ; Experimental Assay: dCp ; Experimental Assay: Tm details:Additives ; Experimental Assay: dHvH details:Additives ; Experimental Assay: Tm details:Additives GdnHCl 2.3 M ; Experimental Assay: dHvH details:Additives GdnHCl 2.3 M ; Experimental Assay: Tm details:Additives GdnHCl 2.2 M ; Experimental Assay: dHvH details:Additives GdnHCl 2.2 M ; Experimental Assay: Tm details:Additives GdnHCl 2.0 M ; Experimental Assay: dHvH details:Additives GdnHCl 2.0 M ; Experimental Assay: Tm details:Additives GdnHCl 1.5 M ; Experimental Assay: dHvH details:Additives GdnHCl 1.5 M ; Experimental Assay: Tm details:Additives GdnHCl 1.0 M ; Experimental Assay: dHvH details:Additives GdnHCl 1.0 M ; Experimental Assay: Tm details:Additives GdnHCl 0.8 M ; Experimental Assay: dHvH details:Additives GdnHCl 0.8 M ; Experimental Assay: Tm details:Additives GdnHCl 0.6 M ; Experimental Assay: dHvH details:Additives GdnHCl 0.6 M ; Experimental Assay: Tm details:Additives GdnHCl 2.5 M ; Experimental Assay: dHvH details:Additives GdnHCl 2.5 M ; Experimental Assay: Tm details:Additives GdnHCl 2.3 M ; Experimental Assay: dHvH details:Additives GdnHCl 2.3 M ; Experimental Assay: Tm details:Additives GdnHCl 2.2 M ; Experimental Assay: dHvH details:Additives GdnHCl 2.2 M ; Experimental Assay: Tm details:Additives GdnHCl 2.0 M ; Experimental Assay: dHvH details:Additives GdnHCl 2.0 M ; Experimental Assay: Tm details:Additives GdnHCl 1.5 M ; Experimental Assay: dHvH details:Additives GdnHCl 1.5 M ; Experimental Assay: Tm details:Additives GdnHCl 1.0 M ; Experimental Assay: dHvH details:Additives GdnHCl 1.0 M ; Experimental Assay: Tm details:Additives GdnHCl 0.8 M ; Experimental Assay: dHvH details:Additives GdnHCl 0.8 M ; Experimental Assay: Tm details:Additives GdnHCl 0.6 M ; Experimental Assay: dHvH details:Additives GdnHCl 0.6 M ; Experimental Assay: Cm ; Experimental Assay: m ; Experimental Assay: dG_H2O units:kJ/mol ; Experimental Assay: Cm ; Experimental Assay: m ; Experimental Assay: dG_H2O units:kJ/mol
Libraries Mutations for sequence GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
Sequence Assay Result Units