Sequence and stability of the goat cytochrome c.


Abstract

We have determined the sequence of mitochondrial cytochrome c (cyt-c) from the goat heart, and it was found to have a unique amino acid sequence among all amino acid sequences of cyt-c reported till date. Its sequence alignment with the bovine cytochrome c (b-cyt-c) led us to conclude that the goat cytochrome c (g-cyt-c) differs in amino acid sequence from b-cyt-c at only one position, i.e., Pro44(bovine) --> Ala44(goat). It has been observed that guanidinium chloride (GdmCl) induces a two-state transition between the native (N) and denatured (D) states of g-cyt-c. This conclusion is reached from the coincidence of GdmCl-induced transition curves monitored by measurements of absorbance at 405, 530 and 695 nm and circular dichroism (CD) at 222, 416 and 405 nm. Analysis of denaturation curves for the Gibbs energy of stabilization suggests that the stability of g-cyt-c is, within experimental errors, identical to that of b-cyt-c. We have also measured the effect of temperature on the equilibrium, N state <--> D state of g-cyt-c in the presence of different GdmCl concentrations. These measurements gave values of transition temperature (T(m)), changes in enthalpy (DeltaH(m)) and heat capacity (DeltaC(p)) of g-cyt-c in the absence of GdmCl, which are compared with those of b-cyt-c. We have used crystal structure coordinates of b-cyt-c to predict the structure and stability of g-cyt-c, which are compared with those of the bovine protein. Study holds ProTherm entries: 25565, 25566, 25567, 25568, 25569, 25570, 25571, 25572, 25573, 25574, 25575, 25576, 25577, 25578, 25579, 25580, 25581, 25582, 25583, 25584, 25585, 25586, 25587, 25588 Extra Details: monited by [theta]222 Folding and stability; Molecular modeling; Goat cytochrome c; Bovine cytochrome c; Circular dichroism

Submission Details

ID: fNkhmM4o

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:55 p.m.

Version: 1

Publication Details
Rahaman H;Khan KA;Hassan I;Wahid M;Singh SB;Singh TP;Moosavi-Movahedi AA;Ahmad F,Biophys. Chem. (2008) Sequence and stability of the goat cytochrome c. PMID:18814948
Additional Information

Study Summary

Number of data points 54
Proteins Mitochondrial cytochrome c
Unique complexes 1
Assays/Quantities/Protocols Experimental Assay: dG_H2O units:kcal/mol ; Experimental Assay: dCp ; Experimental Assay: Tm details:Additives ; Experimental Assay: dHvH details:Additives ; Experimental Assay: Tm details:Additives GdnHCl 2.3 M ; Experimental Assay: dHvH details:Additives GdnHCl 2.3 M ; Experimental Assay: Tm details:Additives GdnHCl 2.2 M ; Experimental Assay: dHvH details:Additives GdnHCl 2.2 M ; Experimental Assay: Tm details:Additives GdnHCl 2.0 M ; Experimental Assay: dHvH details:Additives GdnHCl 2.0 M ; Experimental Assay: Tm details:Additives GdnHCl 1.5 M ; Experimental Assay: dHvH details:Additives GdnHCl 1.5 M ; Experimental Assay: Tm details:Additives GdnHCl 1.0 M ; Experimental Assay: dHvH details:Additives GdnHCl 1.0 M ; Experimental Assay: Tm details:Additives GdnHCl 0.8 M ; Experimental Assay: dHvH details:Additives GdnHCl 0.8 M ; Experimental Assay: Tm details:Additives GdnHCl 0.6 M ; Experimental Assay: dHvH details:Additives GdnHCl 0.6 M ; Experimental Assay: Tm details:Additives GdnHCl 2.5 M ; Experimental Assay: dHvH details:Additives GdnHCl 2.5 M ; Experimental Assay: Tm details:Additives GdnHCl 2.3 M ; Experimental Assay: dHvH details:Additives GdnHCl 2.3 M ; Experimental Assay: Tm details:Additives GdnHCl 2.2 M ; Experimental Assay: dHvH details:Additives GdnHCl 2.2 M ; Experimental Assay: Tm details:Additives GdnHCl 2.0 M ; Experimental Assay: dHvH details:Additives GdnHCl 2.0 M ; Experimental Assay: Tm details:Additives GdnHCl 1.5 M ; Experimental Assay: dHvH details:Additives GdnHCl 1.5 M ; Experimental Assay: Tm details:Additives GdnHCl 1.0 M ; Experimental Assay: dHvH details:Additives GdnHCl 1.0 M ; Experimental Assay: Tm details:Additives GdnHCl 0.8 M ; Experimental Assay: dHvH details:Additives GdnHCl 0.8 M ; Experimental Assay: Tm details:Additives GdnHCl 0.6 M ; Experimental Assay: dHvH details:Additives GdnHCl 0.6 M ; Experimental Assay: Cm ; Experimental Assay: m ; Experimental Assay: dG_H2O units:kJ/mol ; Experimental Assay: Cm ; Experimental Assay: m ; Experimental Assay: dG_H2O units:kJ/mol
Libraries Mutations for sequence GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
99.0 Mitochondrial cytochrome c P62894 CYC_BOVIN
99.0 Mitochondrial cytochrome c P62895 CYC_PIG
99.0 Mitochondrial cytochrome c P62896 CYC_SHEEP
98.1 Mitochondrial cytochrome c P62897 CYC_MOUSE
98.1 Mitochondrial cytochrome c P62898 CYC_RAT
98.1 Mitochondrial cytochrome c P68099 CYC_CAMDR
98.1 Mitochondrial cytochrome c P68100 CYC_ESCRO
98.1 Mitochondrial cytochrome c P68098 CYC_LAMGU
97.1 Mitochondrial cytochrome c Q52V09 CYC_CEPBA
96.2 Mitochondrial cytochrome c P00007 CYC_HIPAM
96.2 Mitochondrial cytochrome c P00008 CYC_RABIT
97.1 Mitochondrial cytochrome c P68097 CYC_EQUAS
97.1 Mitochondrial cytochrome c P68096 CYC_EQUBU
96.2 Mitochondrial cytochrome c P00011 CYC_CANLF
96.2 Mitochondrial cytochrome c P00004 CYC_HORSE
94.2 Mitochondrial cytochrome c B4USV4 CYC_OTOGA
92.3 Mitochondrial cytochrome c Q52V10 CYC_SAISC
95.2 Mitochondrial cytochrome c P00012 CYC_MIRLE
93.3 Mitochondrial cytochrome c P00014 CYC_MACGI
94.2 Mitochondrial cytochrome c P00013 CYC_MINSC
93.1 Mitochondrial cytochrome c P00021 CYC_COLLI
94.1 Mitochondrial cytochrome c P00020 CYC_ANAPL
91.3 Mitochondrial cytochrome c P67881 CYC_CHICK
91.3 Mitochondrial cytochrome c P67882 CYC_MELGA
90.4 Mitochondrial cytochrome c P00017 CYC_APTPA
93.2 Mitochondrial cytochrome c P81280 CYC_ALLMI
90.4 Mitochondrial cytochrome c P00018 CYC_DRONO
90.4 Mitochondrial cytochrome c P00002 CYC_MACMU
90.4 Mitochondrial cytochrome c Q52V08 CYC_MACSY
90.4 Mitochondrial cytochrome c P00024 CYC_LITCT
90.4 Mitochondrial cytochrome c P00019 CYC_STRCA
91.3 Mitochondrial cytochrome c P00022 CYC_CHESE
90.2 Mitochondrial cytochrome c P21665 CYC_VARVA