Reversible denaturation of the gene V protein of bacteriophage f1.
Abstract
The guanidine hydrochloride (GuHCl)-induced denaturation of the gene V protein of bacteriophage f1 has been studied, using the chemical reactivity of a cysteine residue that is buried in the folded protein and the circular dichroism (CD) at 211 and 229 nm as measures of the fraction of polypeptide chains in the folded form. It is found that this dimeric protein unfolds in a single cooperative transition from a folded dimer to two unfolded monomers. A folded, monomeric form of the gene V protein was not detected at equilibrium. The kinetics of unfolding of the gene V protein in 3 M GuHCl and the refolding in 2 M GuHCl are also consistent with a transition between a folded dimer and two unfolded monomers. The GuHCl concentration dependence of the rates of folding and unfolding suggests that the transition state for folding is near the folded conformation. Study holds ProTherm entries: 4228 Extra Details: additive : EDTA(0.001 M), chemical reactivity; cysteine; buried; dimeric protein;,cooperative transition
Submission Details
ID: ey8g9BWU
Submitter: Connie Wang
Submission Date: April 24, 2018, 8:24 p.m.
Version: 1
Publication Details
Liang H;Terwilliger TC,Biochemistry (1991) Reversible denaturation of the gene V protein of bacteriophage f1. PMID:2007116Additional Information
Study Summary
| Number of data points | 1 |
| Proteins | DNA-Binding protein G5P ; DNA-Binding protein G5P |
| Unique complexes | 1 |
| Assays/Quantities/Protocols | Experimental Assay: dG_H2O |
| Libraries | Mutations for sequence MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK |
Structure view and single mutant data analysis
Study data
| Colors: | D | E | R | H | K | S | T | N | Q | A | V | I | L | M | F | Y | W | C | G | P |
|---|
Data Distribution
Studies with similar sequences (approximate matches)