The eye lens protein and chaperonin, alpha-crystallin, was studied by differential scanning microcalorimetry, spectroscopy and size exclusion chromatography. The thermal transition of alpha-crystallin proceeds at Ttrs = 59.8 +/- 0.6 degrees C with an enthalpy change of delta H = 336 +/- 9 kJ per mol subunit. Disagreement between previous delta H values could be attributed to a side reaction that leads, depending on the scan rate, to the formation of a non-productive folding form. The conformational stability of alpha-crystallin is rather low (delta G = 24 +/- 5 kJ/mol of subunit). The minimal cooperative unit of alpha-crystallin is the monomeric subunit. Study holds ProTherm entries: 10810, 10811 Extra Details: alpha-crystallin; heat shock protein; scanning calorimetry;,conformational stability; non-productive folding form
ID: e5VFfrDe
Submitter: Connie Wang
Submission Date: April 24, 2018, 8:41 p.m.
Version: 1
Number of data points | 5 |
Proteins | Alpha-crystallin A chain |
Unique complexes | 1 |
Assays/Quantities/Protocols | Experimental Assay: dCp ; Experimental Assay: dHcal ; Experimental Assay: Tm ; Experimental Assay: dHvH ; Experimental Assay: dG |
Libraries | Mutations for sequence MDIAIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKIPSGVDAGHSERAIPVSREEKPSSAPSS |
Colors: | D | E | R | H | K | S | T | N | Q | A | V | I | L | M | F | Y | W | C | G | P |
---|
Percent Identity | Matching Chains | Protein | Accession | Entry Name |
---|---|---|---|---|
100.0 | Alpha-crystallin A chain | P02470 | CRYAA_BOVIN | |
99.4 | Alpha-crystallin A chain | Q5ENZ0 | CRYAA_SHEEP | |
99.4 | Alpha-crystallin A chain | P68284 | CRYAA_GIRCA | |
99.4 | Alpha-crystallin A chain | P68285 | CRYAA_HIPAM | |
98.8 | Alpha-crystallin A chain | P82531 | CRYAA_PTEPO | |
98.3 | Alpha-crystallin A chain | P02476 | CRYAA_TAPIN | |
98.3 | Alpha-crystallin A chain | P02474 | CRYAA_BALAC | |
97.7 | Alpha-crystallin A chain | P02475 | CRYAA_PIG | |
97.7 | Alpha-crystallin A chain | P02479 | CRYAA_CERSI | |
98.8 | Alpha-crystallin A chain | P02472 | CRYAA_CAMDR | |
98.3 | Alpha-crystallin A chain | P68280 | CRYAA_CANLF | |
98.3 | Alpha-crystallin A chain | P68282 | CRYAA_FELCA | |
97.1 | Alpha-crystallin A chain | P02493 | CRYAA_RABIT | |
97.1 | Alpha-crystallin A chain | P02478 | CRYAA_HORSE | |
97.1 | Alpha-crystallin A chain | P02480 | CRYAA_MELUS | |
97.1 | Alpha-crystallin A chain | P02477 | CRYAA_PHOPH | |
96.5 | Alpha-crystallin A chain | P68281 | CRYAA_CAVPO | |
96.5 | Alpha-crystallin A chain | P68283 | CRYAA_PEDCA | |
97.1 | Alpha-crystallin A chain | P02482 | CRYAA_ARTJA | |
96.0 | Alpha-crystallin A chain | P02494 | CRYAA_EULFU | |
96.5 | Alpha-crystallin A chain | P68289 | CRYAA_HALGR | |
96.5 | Alpha-crystallin A chain | P68288 | CRYAA_ZALCA | |
96.0 | Alpha-crystallin A chain | P02483 | CRYAA_NEOVI | |
96.0 | Alpha-crystallin A chain | P02492 | CRYAA_OCHPR | |
95.4 | Alpha-crystallin A chain | P68287 | CRYAA_OTOCR | |
95.4 | Alpha-crystallin A chain | P68286 | CRYAA_PERPO | |
96.0 | Alpha-crystallin A chain | P68405 | CRYAA_MERUN | |
96.0 | Alpha-crystallin A chain | P68406 | CRYAA_TUPGL | |
95.4 | Alpha-crystallin A chain | P02484 | CRYAA_MANJA | |
94.2 | Alpha-crystallin A chain | A0A140G945 | CRYA2_HUMAN | |
94.2 | Alpha-crystallin A chain | P02489 | CRYAA_HUMAN | |
94.2 | Alpha-crystallin A chain | P02498 | CRYAA_LOXAF | |
94.8 | Alpha-crystallin A chain | P02488 | CRYAA_MACMU | |
92.5 | Alpha-crystallin A chain | P02499 | CRYAA_PROCA | |
92.5 | Alpha-crystallin A chain | P82533 | CRYAA_ERIEU | |
90.8 | Alpha-crystallin A chain | P02501 | CRYAA_ORYAF | |
91.9 | Alpha-crystallin A chain | P02486 | CRYAA_CHOHO | |
90.2 | Alpha-crystallin A chain | P02502 | CRYAA_MACRU | |
90.8 | Alpha-crystallin A chain | P02487 | CRYAA_BRAVA |