The protein stabilizing effects of the small molecule osmolyte, trimethylamine N-oxide, against chemical denaturant was investigated by NMR spin-relaxation measurements and model-free analysis. In the presence of 0.7 M guanidine hydrochloride increased picosecond-nanosecond dynamics are observed in the protein ribonuclease A. These increased fluctuations occur throughout the protein, but the most significant increases in flexibility occur at positions believed to be the first to unfold. Addition of 0.35 M trimethylamine N-oxide to this destabilized form of ribonuclease results in significant rigidification of the protein backbone as assessed by (1)H-(15)N order parameters. Statistically, these order parameters are the same as those measured in native ribonuclease indicating that TMAO reduces the amplitude of backbone fluctuations in a destabilized protein. These data suggest that TMAO restricts the bond vector motions on the protein energy landscape to resemble those motions that occur in the native protein and points to a relation between stability and dynamics in this enzyme. Study holds ProTherm entries: 22287, 22288, 22289 Extra Details: guanidine; protein dynamics; protein stability; NMR spin-relaxation; TMAO
ID: e2AqLi4Y
Submitter: Connie Wang
Submission Date: April 24, 2018, 8:53 p.m.
Version: 1
Number of data points | 3 |
Proteins | Ribonuclease pancreatic ; Ribonuclease pancreatic |
Unique complexes | 1 |
Assays/Quantities/Protocols | Experimental Assay: Tm prot_conc:15 microM ; Experimental Assay: Tm prot_conc:20 microM |
Libraries | Mutations for sequence KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV |
Colors: | D | E | R | H | K | S | T | N | Q | A | V | I | L | M | F | Y | W | C | G | P |
---|
Percent Identity | Matching Chains | Protein | Accession | Entry Name |
---|---|---|---|---|
100.0 | Ribonuclease pancreatic | P61824 | RNAS1_BISBI | |
100.0 | Ribonuclease pancreatic | P61823 | RNAS1_BOVIN | |
96.8 | Ribonuclease pancreatic | P67926 | RNAS1_CAPHI | |
96.8 | Ribonuclease pancreatic | P67927 | RNAS1_SHEEP | |
95.2 | Ribonuclease pancreatic | P00657 | RNAS1_BUBBU | |
96.0 | Ribonuclease pancreatic | P07847 | RNAS1_AEPME | |
93.5 | Ribonuclease pancreatic | P07848 | RNAS1_EUDTH | |
95.2 | Ribonuclease pancreatic | P00660 | RNAS1_CONTA | |
92.7 | Ribonuclease pancreatic | P00668 | RNAS1_ANTAM | |
90.3 | Ribonuclease pancreatic | P00662 | RNAS1_GIRCA | |
96.0 | Ribonuclease pancreatic | Q29606 | RNAS1_ORYLE |