Sulfate anion stabilization of native ribonuclease A both by anion binding and by the Hofmeister effect.


Abstract

Data are reported for T(m), the temperature midpoint of the thermal unfolding curve, of ribonuclease A, versus pH (range 2-9) and salt concentration (range 0-1 M) for two salts, Na(2)SO(4) and NaCl. The results show stabilization by sulfate via anion-specific binding in the concentration range 0-0.1 M and via the Hofmeister effect in the concentration range 0.1-1.0 M. The increase in T(m) caused by anion binding at 0.1 M sulfate is 20 degrees at pH 2 but only 1 degree at pH 9, where the net proton charge on the protein is near 0. The 10 degrees increase in T(m) between 0.1 and 1.0 M Na(2)SO(4), caused by the Hofmeister effect, is independent of pH. A striking property of the NaCl results is the absence of any significant stabilization by 0.1 M NaCl, which indicates that any Debye screening is small. pH-dependent stabilization is produced by 1 M NaCl: the increase in T(m) between 0 and 1.0 M is 14 degrees at pH 2 but only 1 degree at pH 9. The 14 degree increase at pH 2 may result from anion binding or from both binding and Debye screening. Taken together, the results for Na(2)SO(4) and NaCl show that native ribonuclease A is stabilized at low pH in the same manner as molten globule forms of cytochrome c and apomyoglobin, which are stabilized at low pH by low concentrations of sulfate but only by high concentrations of chloride. Study holds ProTherm entries: 15264, 15265, 15266, 15267, 15268, 15269, 15270, 15271, 15272, 15273, 15274, 15275, 15276, 15277, 15278, 15279 Extra Details: Anion-specific binding; protein stabilization; net positive charge; ribonuclease A; thermal unfolding; Hofmeister effect

Submission Details

ID: bkWqjT3B4

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:46 p.m.

Version: 1

Publication Details
Ramos CH;Baldwin RL,Protein Sci. (2002) Sulfate anion stabilization of native ribonuclease A both by anion binding and by the Hofmeister effect. PMID:12070329
Additional Information

Study Summary

Number of data points 48
Proteins Ribonuclease pancreatic ; Ribonuclease pancreatic
Unique complexes 1
Assays/Quantities/Protocols Experimental Assay: Cm ionic:NaSCN: 0.75 M ; Experimental Assay: m ionic:NaSCN: 0.75 M ; Experimental Assay: dG_H2O ionic:NaSCN: 0.75 M ; Experimental Assay: Cm ionic:NaSCN: 0.50 M ; Experimental Assay: m ionic:NaSCN: 0.50 M ; Experimental Assay: dG_H2O ionic:NaSCN: 0.50 M ; Experimental Assay: Cm ionic:NaSCN: 0.25 M ; Experimental Assay: m ionic:NaSCN: 0.25 M ; Experimental Assay: dG_H2O ionic:NaSCN: 0.25 M ; Experimental Assay: Cm ionic:NaSCN: 0.05 M ; Experimental Assay: m ionic:NaSCN: 0.05 M ; Experimental Assay: dG_H2O ionic:NaSCN: 0.05 M ; Experimental Assay: Cm ionic:NaSCN: 0.01 M ; Experimental Assay: m ionic:NaSCN: 0.01 M ; Experimental Assay: dG_H2O ionic:NaSCN: 0.01 M ; Experimental Assay: Cm ionic:Na2SO4: 1.00 M ; Experimental Assay: m ionic:Na2SO4: 1.00 M ; Experimental Assay: dG_H2O ionic:Na2SO4: 1.00 M ; Experimental Assay: Cm ionic:Na2SO4: 0.80 M ; Experimental Assay: m ionic:Na2SO4: 0.80 M ; Experimental Assay: dG_H2O ionic:Na2SO4: 0.80 M ; Experimental Assay: Cm ionic:Na2SO4: 0.50 M ; Experimental Assay: m ionic:Na2SO4: 0.50 M ; Experimental Assay: dG_H2O ionic:Na2SO4: 0.50 M ; Experimental Assay: Cm ionic:Na2SO4: 0.20 M ; Experimental Assay: m ionic:Na2SO4: 0.20 M ; Experimental Assay: dG_H2O ionic:Na2SO4: 0.20 M ; Experimental Assay: Cm ionic:Na2SO4: 0.01 M ; Experimental Assay: m ionic:Na2SO4: 0.01 M ; Experimental Assay: dG_H2O ionic:Na2SO4: 0.01 M ; Experimental Assay: Cm ionic:NaCl: 1.00 M ; Experimental Assay: m ionic:NaCl: 1.00 M ; Experimental Assay: dG_H2O ionic:NaCl: 1.00 M ; Experimental Assay: Cm ionic:NaCl: 0.75 M ; Experimental Assay: m ionic:NaCl: 0.75 M ; Experimental Assay: dG_H2O ionic:NaCl: 0.75 M ; Experimental Assay: Cm ionic:NaCl: 0.50 M ; Experimental Assay: m ionic:NaCl: 0.50 M ; Experimental Assay: dG_H2O ionic:NaCl: 0.50 M ; Experimental Assay: Cm ionic:NaCl: 0.25 M ; Experimental Assay: m ionic:NaCl: 0.25 M ; Experimental Assay: dG_H2O ionic:NaCl: 0.25 M ; Experimental Assay: Cm ionic:NaCl: 0.01 M ; Experimental Assay: m ionic:NaCl: 0.01 M ; Experimental Assay: dG_H2O ionic:NaCl: 0.01 M ; Experimental Assay: Cm ionic:: ; Experimental Assay: m ionic:: ; Experimental Assay: dG_H2O ionic::
Libraries Mutations for sequence KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant PDB Entries

Structure ID Release Date Resolution Structure Title
2AAS 1994-01-31 HIGH-RESOLUTION THREE-DIMENSIONAL STRUCTURE OF RIBONUCLEASE A IN SOLUTION BY NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY
6ETK 2018-02-21 0.85 Atomic resolution structure of RNase A (data collection 1)
6ETL 2018-02-21 0.85 Atomic resolution structure of RNase A (data collection 2)
1DY5 2000-03-28 0.87 Deamidated derivative of bovine pancreatic ribonuclease
6ETM 2018-02-21 0.92 Atomic resolution structure of RNase A (data collection 3)
6ETN 2018-02-21 0.92 Atomic resolution structure of RNase A (data collection 4)
6ETO 2018-02-21 1.02 Atomic resolution structure of RNase A (data collection 5)
6ETP 2018-02-21 1.02 Atomic resolution structure of RNase A (data collection 6)
2E3W 2007-10-30 1.05 X-ray structure of native RNase A
1KF3 2001-12-19 1.05 Atomic Resolution Structure of RNase A at pH 5.9
6ETQ 2018-02-21 1.08 Atomic resolution structure of RNase A (data collection 7)
2NUI 2007-10-30 1.1 X-ray Structure of synthetic [D83A]RNase A
1KF2 2001-12-19 1.1 Atomic Resolution Structure of RNase A at pH 5.2
2P45 2008-03-11 1.1 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.1A resolution: SE5B-ORTHO-1 crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
1KF4 2001-12-19 1.1 Atomic Resolution Structure of RNase A at pH 6.3
6F60 2018-04-25 1.14 The x-ray structure of bovine pancreatic ribonuclease in complex with a five-coordinate platinum(II) compound containing a sugar ligand
1KF5 2001-12-19 1.15 Atomic Resolution Structure of RNase A at pH 7.1
1KF8 2001-12-19 1.15 Atomic resolution structure of RNase A at pH 8.8
1KF7 2001-12-19 1.15 Atomic Resolution Structure of RNase A at pH 8.0
5OGH 2018-08-01 1.16 Structure of RNase A at high resolution (1.16 A) in complex with 3'-CMP and sulphate ions
6ETR 2018-02-21 1.17 Atomic resolution structure of RNase A (data collection 8)
1O0O 2003-12-09 1.2 Ribonuclease A in complex with adenosine-2',5'-diphosphate
1O0H 2003-12-09 1.2 Ribonuclease A in complex with 5'-ADP
4O36 2014-05-07 1.22 Semisynthetic RNase S1-15-H7/11-Q10
1RUV 1997-04-01 1.25 RIBONUCLEASE A-URIDINE VANADATE COMPLEX: HIGH RESOLUTION RESOLUTION X-RAY STRUCTURE (1.3 A)
7RSA 1988-10-09 1.26 STRUCTURE OF PHOSPHATE-FREE RIBONUCLEASE A REFINED AT 1.26 ANGSTROMS
3QL1 2012-02-29 1.29 Crystal Structure of Ribonuclease A Variant A4C/D83E/V118C
3I6J 2010-07-07 1.3 Ribonuclease A by Classical hanging drop method after high X-Ray dose on ESRF ID14-2 beamline
3I6F 2010-07-07 1.3 Ribonuclease A by Classical hanging drop method before high X-Ray dose on ESRF ID14-2 beamline
3I6H 2010-07-07 1.3 Ribonuclease A by LB nanotemplate method before high X-Ray dose on ESRF ID14-2 beamline
3I67 2010-07-07 1.3 Ribonuclease A by LB nanotemplate method after high X-Ray dose on ESRF ID14-2 beamline
2QCA 2007-07-03 1.33 A New Crystal Form of Bovine Pancreatic RNase A in Complex with 2'-Deoxyguanosine-5'-monophosphate
2P49 2007-08-28 1.38 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.4A resolution: native mono_1 crystal form
4K7L 2014-05-14 1.38 Crystal structure of RNase S variant (K7C/Q11C)
3DXG 2009-06-16 1.39 Ribonuclease A- uridine 5' phosphate complex
2BLP 2005-09-07 1.4 RNase before unattenuated X-RAY burn
3DXH 2009-06-16 1.4 Ribonuclease A uridine 5' diphosphate complex
1FS3 2002-02-13 1.4 CRYSTAL STRUCTURE OF WILD-TYPE BOVINE PANCREATIC RIBONUCLEASE A
1EIC 2002-02-13 1.4 CRYSTAL STRUCTURE OF F120A MUTANT OF BOVINE PANCREATIC RIBONUCLEASE A
1EID 2002-02-13 1.4 CRYSTAL STRUCTURE OF F120G MUTANT OF BOVINE PANCREATIC RIBONUCLEASE A
3DIB 2008-07-15 1.4 Crystal structure of bovine pancreatic ribonuclease A variant (I106A)
1EIE 2002-02-13 1.4 CRYSTAL STRUCTURE OF F120W MUTANT OF BOVINE PANCREATIC RIBONUCLEASE A
2BLZ 2005-09-07 1.4 RNAse after a high dose X-ray 'burn'
4O37 2014-05-07 1.4 seminsynthetic RNase S1-15-3Pl-7/11
1RPG 1994-12-20 1.4 STRUCTURES OF RNASE A COMPLEXED WITH 3'-CMP AND D(CPA): ACTIVE SITE CONFORMATION AND CONSERVED WATER MOLECULES
3RN3 1991-10-31 1.45 SEGMENTED ANISOTROPIC REFINEMENT OF BOVINE RIBONUCLEASE A BY THE APPLICATION OF THE RIGID-BODY TLS MODEL
1YMN 2006-01-31 1.45 The study of reductive unfolding pathways of RNase A (Y92L mutant)
4WYZ 2015-11-18 1.45 The crystal structure of the A109G mutant of RNase A in complex with 3'UMP
3OQY 2010-10-20 1.49 Semi-synthetic ribonuclease S: para-cyano-phenylalanine at position 8
3QL2 2012-02-29 1.49 Crystal Structure of Ribonuclease A Variant A4C/D83E/V118C
4WYP 2015-11-18 1.5 The crystal structure of the A109G mutant of RNase A in complex with 5'AMP
4RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
1RNC 1994-01-31 1.5 NEWLY OBSERVED BINDING MODE IN PANCREATIC RIBONUCLEASE
5RAT 1993-07-15 1.5 Effects of temperature on protein structure and dynamics: X-ray crystallographic studies of the protein ribonuclease-A at nine different temperatures from 98 TO 320 K
2G8Q 2006-08-15 1.5 The crystal structure of RNase A from monoclinic crystals at 100 K
1RHB 1995-02-27 1.5 WATER DEPENDENT DOMAIN MOTION AND FLEXIBILITY IN RIBONUCLEASE A AND THE INVARIANT FEATURES IN ITS HYDRATION SHELL. AN X-RAY STUDY OF TWO LOW HUMIDITY CRYSTAL FORMS OF THE ENZYME
1RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
3MZQ 2011-05-25 1.5 RNase crystals grown by the hanging drop method
2RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
1RND 1994-01-31 1.5 NEWLY OBSERVED BINDING MODE IN PANCREATIC RIBONUCLEASE
1IZR 2003-11-25 1.5 F46A mutant of bovine pancreatic ribonuclease A
1O0M 2003-12-09 1.5 Ribonuclease A in complex with uridine-2'-phosphate
1YMW 2006-01-31 1.5 The study of reductive unfolding pathways of RNase A (Y92G mutant)
1Z6S 2005-08-16 1.5 Ribonuclease A- AMP complex
1IZP 2003-11-25 1.5 F46L mutant of bovine pancreatic ribonuclease A
1O0F 2003-12-09 1.5 RNASE A in complex with 3',5'-ADP
1YMR 2006-01-31 1.5 The study of reductive unfolding pathways of RNase A (Y92A mutant)
7RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
8RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
6RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
3MZR 2011-05-25 1.5 RNase crystals grown in loops/micromounts
1O0N 2003-12-09 1.5 Ribonuclease A in complex with uridine-3'-phosphate
9RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
3RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
5D6U 2016-04-06 1.52 X-ray crystal structure of ribonuclease A determined for the real space D/H contrast method
4OKF 2015-03-04 1.54 RNase S in complex with an artificial peptide
1Z6D 2005-08-16 1.54 Ribonuclease A- IMP complex
3LXO 2010-04-28 1.55 The crystal structure of ribonuclease A in complex with thymidine-3'-monophosphate
3D6O 2009-02-10 1.58 The RNase A- 5'-Deoxy-5'-N-(ethyl isonipecotatyl)uridine complex
4AO1 2012-07-18 1.58 High resolution crystal structure of bovine pancreatic ribonuclease crystallized using ionic liquid
3D6P 2009-02-10 1.6 RNase A- 5'-Deoxy-5'-N-morpholinouridine complex
1RNU 1994-01-31 1.6 REFINEMENT OF THE CRYSTAL STRUCTURE OF RIBONUCLEASE S. COMPARISON WITH AND BETWEEN THE VARIOUS RIBONUCLEASE A STRUCTURES
1A5P 1998-05-27 1.6 C[40,95]A VARIANT OF BOVINE PANCREATIC RIBONUCLEASE A
4RSD 1998-07-15 1.6 STRUCTURE OF THE D121A VARIANT OF RIBONUCLEASE A
3FL3 2009-03-24 1.6 X-ray structure of the ligand free non covalent swapped form of the A19P/Q28L/K31C/S32C mutant of bovine pancreatic ribonuclease
3JW1 2009-10-06 1.6 Crystal Structure of Bovine Pancreatic Ribonuclease Complexed with Uridine-5'-monophosphate at 1.60 A Resolution
1W4O 2005-02-02 1.6 Binding of Nonnatural 3'-Nucleotides to Ribonuclease A
1ROB 1994-01-31 1.6 STRUCTURE OF THE CRYSTALLINE COMPLEX OF CYTIDYLIC ACID (2'-CMP) WITH RIBONUCLEASE AT 1.6 ANGSTROMS RESOLUTION
3DH6 2008-07-15 1.6 Crystal structure of bovine pancreatic ribonuclease A variant (V47A)
2RNS 1994-01-31 1.6 REFINEMENT OF THE CRYSTAL STRUCTURE OF RIBONUCLEASE S. COMPARISON WITH AND BETWEEN THE VARIOUS RIBONUCLEASE A STRUCTURES
2OP2 2007-10-30 1.6 Crystal structure of RNase double-mutant V43C R85C with extra disulphide bond
3DI8 2008-07-15 1.6 Crystal structure of bovine pancreatic ribonuclease A variant (V57A)
3D6Q 2009-02-10 1.6 The RNase A- 5'-Deoxy-5'-N-piperidinouridine complex
3DI7 2008-07-15 1.6 Crystal structure of bovine pancreatic ribonuclease A variant (V54A)
3DIC 2008-07-15 1.6 Crystal structure of bovine pancreatic ribonuclease A variant (V108A)
3DH5 2008-07-15 1.6 Crystal structure of bovine pancreatic ribonuclease A (wild-type)
3D7B 2009-02-10 1.6 The Ribonuclease A- 5'-Deoxy-5'-N-pyrrolidinouridine complex
1BEL 1996-10-14 1.6 HYDROLASE PHOSPHORIC DIESTER, RNA
3RSD 1998-07-15 1.6 STRUCTURE OF THE D121N VARIANT OF RIBONUCLEASE A
1RNV 1994-01-31 1.6 REFINEMENT OF THE CRYSTAL STRUCTURE OF RIBONUCLEASE S. COMPARISON WITH AND BETWEEN THE VARIOUS RIBONUCLEASE A STRUCTURES
2P43 2008-03-11 1.65 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.65A resolution: SE3-mono-1 crystal form with three se-met sites (M34, M51, M83) in vhh scaffold
4L55 2014-01-29 1.65 X-ray structure of the adduct between bovine pancreatic ribonuclease and AziRu
3EUX 2009-06-23 1.65 Crystal Structure of Crosslinked Ribonuclease A
3MWQ 2011-02-09 1.68 Crystal structure of ribonuclease A tandem enzymes and their interaction with the cytosolic ribonuclease inhibitor
5E5F 2015-12-09 1.68 X-ray structure of the complex between RNase A and compound 4-PF6 ([(PPh3)Au(mi-pbi)Pt(Me)(DMSO)][PF6]), the heterobimetallic derivative obtained in the reaction between the organometallic compound [Pt(pbi)(Me)(DMSO)], pbi=2-(2'-pyridil)benzimidazole (compound 3) and the gold(I) compound [Au(Ph3P)][PF6]
3EV5 2009-06-23 1.68 Crystal Structure of Ribonuclease A in 1M Trimethylamine N-Oxide
1W4Q 2005-02-02 1.68 Binding of Nonnatural 3'-Nucleotides to Ribonuclease A
3EV3 2009-06-23 1.68 Crystal Structure of Ribonuclease A in 70% t-Butanol
4J60 2014-01-22 1.69 Crystal structure of Ribonuclease A soaked in 25% Cyclopentanol: One of twelve in MSCS set
1RBX 1995-10-15 1.69 RIBONUCLEASE A (E.C.3.1.27.5) CONTROL
1RBW 1995-10-15 1.69 RIBONUCLEASE A (E.C.3.1.27.5) WITH GUANIDINIUM
4J61 2014-01-22 1.69 Crystal structure of Ribonuclease A soaked in 40% Cyclopentanone: One of twelve in MSCS set
1W4P 2005-02-02 1.69 Binding of Nonnatural 3'-Nucleotides to Ribonuclease A
1RBH 1993-10-31 1.7 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
1AFL 1998-03-18 1.7 RIBONUCLEASE A IN COMPLEX WITH 5'-DIPHOSPHOADENOSINE 2'-PHOSPHATE AT 1.7 ANGSTROM RESOLUTION
3A1R 2009-09-01 1.7 Neutron crystal structure analysis of bovine pancreatic ribonuclease A
3RSP 1998-04-22 1.7 STRUCTURE OF THE P93G VARIANT OF RIBONUCLEASE A
1RBD 1993-10-31 1.7 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
1QHC 1999-08-31 1.7 CRYSTAL STRUCTURE OF RIBONUCLEASE A IN COMPLEX WITH 5'-PHOSPHO-2'-DEOXYURIDINE-3'-PYROPHOSPHATE ADENOSINE-3'-PHOSPHATE
2W5K 2009-02-17 1.7 RNASE A-NADPH COMPLEX
1AFK 1998-03-18 1.7 CRYSTAL STRUCTURE OF RIBONUCLEASE A IN COMPLEX WITH 5'-DIPHOSPHOADENOSINE-3'-PHOSPHATE
1F0V 2001-02-21 1.7 Crystal structure of an Rnase A dimer displaying a new type of 3D domain swapping
1RAS 1993-10-31 1.7 CRYSTAL STRUCTURE OF A FLUORESCENT DERIVATIVE OF RNASE A
2W5L 2009-02-17 1.7 RNASE A-NADP COMPLEX
2W5G 2009-02-17 1.7 RNASE A-5'-ATP COMPLEX
4G8V 2012-11-21 1.7 Crystal structure of Ribonuclease A in complex with 5a
1C9V 2001-06-27 1.7 H12A VARIANT OF RIBONUCLEASE A
2G8R 2006-08-15 1.7 The crystal structure of the RNase A- 3-N-piperidine-4-carboxyl-3-deoxy-ara-uridine complex
3D8Y 2009-02-10 1.72 RNase A- 5'-Deoxy-5'-N-piperidinothymidine complex
2XOI 2011-01-19 1.72 Functional and Structural Analyses of N-Acylsulfonamide-Linked Dinucleoside Inhibitors of Ribonuclease A
2XOG 2011-01-19 1.72 Functional and Structural Analyses of N-Acylsulfonamide-Linked Dinucleoside Inhibitors of Ribonuclease A
4POU 2014-09-24 1.75 VHH-metal in Complex with RNase A
1RBE 1993-10-31 1.75 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
3QSK 2011-08-10 1.75 5 Histidine Variant of the anti-RNase A VHH in Complex with RNAse A
3EV6 2009-06-23 1.76 Crystal Structure of Ribonuclease A in 50% R,S,R-Bisfuranol
3EV0 2009-06-23 1.76 Crystal Structure of Ribonuclease A in 70% Dimethyl Sulfoxide
5OLD 2018-08-29 1.78 X-ray structure of the adduct formed upon reaction of ribonuclease A with a tetranuclear Pt-thiosemicarbazone compound
1JVU 2002-06-05 1.78 CRYSTAL STRUCTURE OF RIBONUCLEASE A (COMPLEXED FORM)
4J64 2014-01-22 1.78 Crystal structure of Ribonuclease A soaked in 40% Dioxane: One of twelve in MSCS set
4J68 2014-01-22 1.78 Crystal structure of Ribonuclease A soaked in 40% Isopropanol: One of twelve in MSCS set
5JLG 2016-08-03 1.79 The X-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and compound I, a piano-stool organometallic Ru(II) arene compound containing an O,S-chelating ligand
1SRN 1990-10-15 1.8 THE REFINED CRYSTAL STRUCTURE OF A FULLY ACTIVE SEMISYNTHETIC RIBONUCLEASE AT 1.8 ANGSTROMS RESOLUTION
4K7M 2013-11-27 1.8 Crystal structure of RNase S variant (K7C/Q11C) with bound mercury ions
5D97 2016-04-06 1.8 Neutron crystal structure of H2O-solvent ribonuclease A
4ZZ4 2016-04-06 1.8 Neutron crystal structure of ribonuclease A determined by the real space D/H contrast method
4WYN 2015-11-18 1.8 The crystal structure of the A109G mutant of RNase A
1C8W 2002-05-01 1.8 THR45GLY VARIANT OF RIBONUCLEASE A
9RSA 1991-04-15 1.8 CRYSTAL STRUCTURE OF TWO COVALENT NUCLEOSIDE DERIVATIVES OF RIBONUCLEASE A
1RBF 1993-10-31 1.8 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
1RBI 1993-10-31 1.8 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
4J5Z 2014-01-22 1.8 Crystal structure of Ribonuclease A in aqueous solution: One of twelve in MSCS set
1C9X 2001-06-27 1.8 H119A VARIANT OF RIBONUCLEASE A
1RNW 1997-04-01 1.8 RECOMBINANT RIBONUCLEASE A CRYSTALLIZED FROM 80% AMMONIUM SULPHATE
1RNN 1996-04-03 1.8 RIBONUCLEASE A COMPLEX WITH CYTIDYLIC ACID (5'CMP) CRYSTALLIZED FROM 8M SODIUM FORMATE
1RBG 1993-10-31 1.8 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
2W5M 2009-02-17 1.8 RNASE A-PYROPHOSPHATE ION COMPLEX
2P42 2008-03-11 1.8 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.8A resolution: SE3-mono-2 crystal form with three se-met sites (M34, M51, M83) in vhh scaffold
1IZQ 2003-11-25 1.8 F46V mutant of bovine pancreatic ribonuclease A
1JN4 2003-06-03 1.8 The Crystal Structure of Ribonuclease A in complex with 2'-deoxyuridine 3'-pyrophosphate (P'-5') adenosine
1RHA 1995-02-27 1.8 WATER DEPENDENT DOMAIN MOTION AND FLEXIBILITY IN RIBONUCLEASE A AND THE INVARIANT FEATURES IN ITS HYDRATION SHELL. AN X-RAY STUDY OF TWO LOW HUMIDITY CRYSTAL FORMS OF THE ENZYME
8RSA 1991-04-15 1.8 CRYSTAL STRUCTURE OF TWO COVALENT NUCLEOSIDE DERIVATIVES OF RIBONUCLEASE A
2P44 2008-03-11 1.8 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.8A resolution: SE5A-mono-1 crystal form with five se-met sites (M34, M51, F68M, M83, L86M) in vhh scaffold
4G8Y 2012-11-21 1.8 Crystal structure of Ribonuclease A in complex with 5b
1XPS 1998-05-27 1.8 BOVINE RIBONUCLEASE A (PHOSPHATE-FREE) (93 % HUMIDITY)
1Z3L 2005-03-29 1.8 X-Ray Crystal Structure of a Mutant Ribonuclease S (F8Anb)
2APQ 2005-09-13 1.8 Crystal Structure of an Active Site Mutant of Bovine Pancreatic Ribonuclease A (H119A-RNase A) with a 10-Glutamine expansion in the C-terminal hinge-loop.
5OBE 2017-07-26 1.82 X-ray structure of the adduct formed upon reaction of ribonuclease A with the compound fac-[RuII(CO)3Cl2(N3-MBI), MBI=methyl-benzimidazole
3EUZ 2009-06-23 1.84 Crystal Structure of Ribonuclease A in 50% Dimethylformamide
2G4W 2007-02-20 1.84 anomalous substructure of ribonuclease A (C2)
5JMG 2016-07-27 1.85 X-ray structure of the complex between bovine pancreatic ribonuclease and pentachlorocarbonyliridate(III) (4 days of soaking)
3MWR 2011-02-09 1.85 Crystal structure of ribonuclease A tandem enzymes and their interaction with the cytosolic ribonuclease inhibitor
4OT4 2014-07-09 1.85 X-ray Structure of the Adduct formed between cisplatin and Ribonuclease A
2RLN 1994-11-01 1.85 THERMODYNAMIC AND STRUCTURAL CONSEQUENCES OF CHANGING A SULPHUR ATOM TO A METHYLENE GROUP IN THE M13NLE MUTATION IN RIBONUCLEASE S
4J67 2014-01-22 1.86 Crystal structure of Ribonuclease A soaked in 50% 1,6-Hexanediol: One of twelve in MSCS set
4OOH 2015-02-25 1.89 Structure of RIBONUCLEASE A at 40C
4J69 2014-01-22 1.89 Crystal structure of Ribonuclease A soaked in 50% S,R,S-bisfuranol: One of twelve in MSCS set
3FL1 2009-03-24 1.9 X-ray structure of the non covalent swapped form of the A19P/Q28L/K31C/S32C mutant of bovine pancreatic ribonuclease in complex with 2'-DEOXYCYTIDINE-2'-DEOXYGUANOSINE-3',5'-MONOPHOSPHATE
1C0B 1999-10-14 1.9 BOVINE PANCREATIC RIBONUCLEASE A DESICCATED FOR 2.5 DAYS
1RNO 1996-04-03 1.9 RIBONUCLEASE A CRYSTALLIZED FROM 80% AMMONIUM SULPHATE
1LSQ 1997-01-11 1.9 RIBONUCLEASE A WITH ASN 67 REPLACED BY A BETA-ASPARTYL RESIDUE
1RCA 1995-09-15 1.9 STRUCTURE OF THE CRYSTALLINE COMPLEX OF DEOXYCYTIDYLYL-3',5'-GUANOSINE (3',5'-DCPDG) CO-CRYSTALISED WITH RIBONUCLEASE AT 1.9 ANGSTROMS RESOLUTION. RETROBINDING IN PANCREATIC RNASEA IS INDEPENDENT OF MODE OF INHIBITOR INTROMISSION
1XPT 1998-05-27 1.9 BOVINE RIBONUCLEASE A (PHOSPHATE-FREE)
1RNZ 1997-04-01 1.9 RIBONUCLEASE A CRYSTALLIZED FROM 2.5M SODIUM CHLORIDE, 3.3M SODIUM FORMATE
1RAR 1993-10-31 1.9 CRYSTAL STRUCTURE OF A FLUORESCENT DERIVATIVE OF RNASE A
1RNX 1996-11-08 1.9 RIBONUCLEASE A CRYSTALLIZED FROM 3M SODIUM CHLORIDE, 30% AMMONIUM SULFATE
1WBU 2005-01-27 1.9 Fragment based lead discovery using crystallography
2P4A 2007-08-28 1.9 X-ray structure of a camelid affinity matured single-domain vhh antibody fragment in complex with RNASE A
4G90 2012-11-21 1.9 Crystal structure of Ribonuclease A in complex with 5e
3EV4 2009-06-23 1.93 Crystal Structure of Ribonuclease A in 50% Trifluoroethanol
3FL0 2009-03-24 1.94 X-ray structure of the non covalent swapped form of the Q28L/K31C/S32C mutant of bovine pancreatic ribonuclease in complex with 2'-DEOXYCYTIDINE-2'-DEOXYGUANOSINE-3',5'-MONOPHOSPHATE
2G4X 2007-02-20 1.95 Anomalous substructure od ribonuclease A (P3221)
4RTE 2015-03-25 1.95 The X-ray structure of bovine pancreatic ribonuclease incubated in the presence of an excess of cisplatin (1:10 ratio)
3EUY 2009-06-23 1.95 Crystal Structure of Ribonuclease A in 50% Dioxane
4J65 2014-01-22 1.96 Crystal structure of Ribonuclease A soaked in 40% Dimethylformamide: One of twelve in MSCS set
5OBD 2017-07-26 1.98 X-ray structure of the adduct formed upon reaction of ribonuclease A with the compound fac-[RuII(CO)3Cl2(N3-MIM), MIM=methyl-imidazole
3D8Z 2009-02-10 1.98 RNase A- 5'-Deoxy-5'-N-pyrrolidinothymidine complex
5E5E 2015-12-09 1.98 X-ray structure of the adduct formed in the reaction between RNase A and a neutral organometallic derivative [Pt(pbi)(Me)(DMSO)], pbi=2-(2'-pyridil)benzimidazole (compound 3)
3FKZ 2009-03-24 1.99 X-ray structure of the non covalent swapped form of the S16G/T17N/A19P/A20S/K31C/S32C mutant of bovine pancreatic ribonuclease
1U1B 2005-06-28 2.0 Structure of bovine pancreatic Ribonuclease A in complex with 3'-phosphothymidine (3'-5')-pyrophosphate adenosine 3'-phosphate
1SSC 1995-01-26 2.0 THE 1.6 ANGSTROMS STRUCTURE OF A SEMISYNTHETIC RIBONUCLEASE CRYSTALLIZED FROM AQUEOUS ETHANOL. COMPARISON WITH CRYSTALS FROM SALT SOLUTIONS AND WITH RNASE A FROM AQUEOUS ALCOHOL SOLUTIONS
3RSK 1998-07-15 2.0 STRUCTURE OF THE K7A/R10A/K66A VARIANT OF RIBONUCLEASE A
1SSA 1994-09-30 2.0 A STRUCTURAL INVESTIGATION OF CATALYTICALLY MODIFIED F12OL AND F12OY SEMISYNTHETIC RIBONUCLEASES
5RSA 1985-07-17 2.0 COMPARISON OF TWO INDEPENDENTLY REFINED MODELS OF RIBONUCLEASE-A
3SRN 1994-12-20 2.0 STRUCTURAL CHANGES THAT ACCOMPANY THE REDUCED CATALYTIC EFFICIENCY OF TWO SEMISYNTHETIC RIBONUCLEASE ANALOGS
1C0C 1999-10-14 2.0 BOVINE PANCREATIC RIBONUCLEASE A DESICCATED FOR 4.0 DAYS
1RBC 1993-10-31 2.0 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
1Z3P 2005-03-29 2.0 X-Ray crystal structure of a mutant Ribonuclease S (M13Nva)
1RNM 1996-04-03 2.0 RIBONUCLEASE A COMPLEX WITH CYTIDYLIC ACID (5'CMP) CRYSTALLIZED FROM 80% AMMONIUM SULPHATE
1B6V 1999-06-15 2.0 CRYSTAL STRUCTURE OF A HYBRID BETWEEN RIBONUCLEASE A AND BOVINE SEMINAL RIBONUCLEASE
1Z3M 2005-03-29 2.0 Crystal structure of mutant Ribonuclease S (F8Nva)
1SSB 1994-09-30 2.0 A STRUCTURAL INVESTIGATION OF CATALYTICALLY MODIFIED F12OL AND F12OY SEMISYNTHETIC RIBONUCLEASES
1RNY 1996-11-08 2.0 RIBONUCLEASE A CRYSTALLIZED FROM 3M CESIUM CHLORIDE, 30% AMMONIUM SULFATE
1AQP 1998-05-27 2.0 RIBONUCLEASE A COPPER COMPLEX
1EOW 2000-11-17 2.0 CRYSTAL STRUCTURE OF RIBONUCLEASE A COMPLEXED WITH URIDYLYL(2',5')GUANOSINE (NON-PRODUCTIVE BINDING)
3EV1 2009-06-23 2.0 Crystal Structure of Ribonuclease A in 70% Hexanediol
6RSA 1986-05-07 2.0 NUCLEAR MAGNETIC RESONANCE AND NEUTRON DIFFRACTION STUDIES OF THE COMPLEX OF RIBONUCLEASE*A WITH URIDINE VANADATE, A TRANSITION-STATE ANALOGUE
1KH8 2003-06-17 2.0 Structure of a cis-proline (P114) to glycine variant of Ribonuclease A
3DI9 2008-07-15 2.0 Crystal structure of bovine pancreatic ribonuclease A variant (I81A)
1RNQ 1996-04-03 2.0 RIBONUCLEASE A CRYSTALLIZED FROM 8M SODIUM FORMATE
4SRN 1994-12-20 2.0 STRUCTURAL CHANGES THAT ACCOMPANY THE REDUCED CATALYTIC EFFICIENCY OF TWO SEMISYNTHETIC RIBONUCLEASE ANALOGS
1RSM 1986-01-21 2.0 THE 2-ANGSTROMS RESOLUTION STRUCTURE OF A THERMOSTABLE RIBONUCLEASE A CHEMICALLY CROSS-LINKED BETWEEN LYSINE RESIDUES 7 AND 41
1AFU 1998-03-18 2.0 STRUCTURE OF RIBONUCLEASE A AT 2.0 ANGSTROMS FROM MONOCLINIC CRYSTALS
4QH3 2014-07-30 2.0 X-ray structure of the adduct formed between bovine pancreatic ribonuclease and trans-dimethylamine methylamine dichlorido platinum(II)
1EOS 2000-08-30 2.0 CRYSTAL STRUCTURE OF RIBONUCLEASE A COMPLEXED WITH URIDYLYL(2',5')GUANOSINE (PRODUCTIVE BINDING)
3EV2 2009-06-23 2.02 Crystal Structure of Ribonuclease A in 70% Isopropanol
6QE9 2019-02-27 2.03 The X-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and complex I, a pentacoordinate Pt(II) compound containing 2,9-dimethyl-1,10-phenanthroline, dimethylfumarate, methyl and iodine as ligands
4J6A 2014-01-22 2.04 Crystal structure of Ribonuclease A soaked in 40% 2,2,2-Trifluoroethanol: One of twelve in MSCS set
4J62 2014-01-22 2.04 Crystal structure of Ribonuclease A soaked in 40% Cyclohexanol: One of twelve in MSCS set
4J63 2014-01-22 2.04 Crystal structure of Ribonuclease A soaked in 40% Cyclohexanone: One of twelve in MSCS set
4J66 2014-01-22 2.04 Crystal structure of Ribonuclease A soaked in 25% Dimethyl sulfoxide: One of twelve in MSCS set
1JVT 2002-06-05 2.05 CRYSTAL STRUCTURE OF RIBONUCLEASE A (LIGAND-FREE FORM)
5NA9 2017-08-16 2.07 The X-ray structure of bovine pancreatic ribonuclease incubated in the presence of an excess of carboplatin (1:10 ratio)
5OBC 2017-07-26 2.07 X-ray structure of the adduct formed upon reaction of ribonuclease A with the compound fac-[RuII(CO)3Cl2(N3-IM), IM=imidazole
4S0Q 2015-11-18 2.09 The X-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and carboplatin
1A2W 1998-04-29 2.1 CRYSTAL STRUCTURE OF A 3D DOMAIN-SWAPPED DIMER OF BOVINE PANCREATIC RIBONUCLEASE A
3MX8 2011-02-09 2.1 Crystal structure of ribonuclease A tandem enzymes and their interaction with the cytosolic ribonuclease inhibitor
5ET4 2016-11-30 2.1 Structure of RNase A-K7H/R10H in complex with 3'-CMP
1GV7 2002-08-22 2.1 ARH-I, an angiogenin/RNase A chimera
1RBN 1994-12-20 2.1 THE STRUCTURE OF RIBONUCLEASE A DERIVATIVE II AT 2.1 ANGSTROMS RESOLUTION
3RH1 2012-02-15 2.1 X-ray Structure of a cis-proline (P114) to alanine variant of Ribonuclease A
4RSK 1998-12-09 2.1 STRUCTURE OF THE K7A/R10A/K66A VARIANT OF RIBONUCLEASE A COMPLEXED WITH 3'-UMP
1J80 2001-06-06 2.1 Osmolyte Stabilization of RNase
5NJ7 2018-05-16 2.15 The X-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and arsenoplatin-1
4YGW 2015-07-01 2.18 RNase S in complex with stabilized S peptide
3RID 2012-02-15 2.18 X-ray structure of the C-terminal swapped dimer of P114A variant of Ribonuclease A
1J81 2001-06-06 2.2 Osmolyte Stabilization of RNase
1JS0 2002-03-13 2.2 Crystal Structure of 3D Domain-swapped RNase A Minor Trimer
1RPF 1994-12-20 2.2 THE STRUCTURES OF RNASE COMPLEXED WITH 3'-CMP AND D(CPA): ACTIVE SITE CONFORMATION AND CONSERVED WATER MOLECULES
1JVV 2002-06-05 2.2 CRYSTAL STRUCTURE OF RIBONUCLEASE A (RETRO-SOAKED FORM)
1RPH 1994-12-20 2.2 STRUCTURES OF RNASE A COMPLEXED WITH 3'-CMP AND D(CPA): ACTIVE SITE CONFORMATION AND CONSERVED WATER MOLECULES
4PEQ 2014-06-25 2.21 Structure of bovine ribonuclease inhibitor complexed with bovine ribonuclease I
1D5E 1999-10-20 2.25 The role of phenylalanine 8 in the stabilization of the S protein-S peptide interaction: Packing and cavities
1J7Z 2001-06-06 2.25 Osmolyte Stabilization of Ribonuclease
1FEV 2000-08-09 2.25 CRYSTAL STRUCTURE OF THE ALA4AIB MUTATION IN RNASE S
1D5D 1999-10-20 2.25 The role of phenylalanine 8 in the stabilization of the s protein-s peptide interaction: packing and cavities
4MXF 2013-12-25 2.25 X-ray structure of the adduct between bovine pancreatic ribonuclease and Auoxo6, a dinuclear gold(III) complex with -dioxo bridges linking the two metal centers
1D5H 1999-10-20 2.25 Rnase s(f8a). mutant ribonucleasE S.
4S18 2015-11-25 2.27 The X-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and oxaliplatin
5JML 2016-07-27 2.29 X-ray structure of the complex between bovine pancreatic ribonuclease and penthachlorocarbonyliridate(III) (2 months of soaking)
2OQF 2008-02-12 2.3 Structure of a synthetic, non-natural analogue of RNase A: [N71K(Ade), D83A]RNase A
1A5Q 1998-05-27 2.3 P93A VARIANT OF BOVINE PANCREATIC RIBONUCLEASE A
2P48 2008-03-11 2.3 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 2.3A resolution: SE5B-tetra crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
3OR0 2010-10-20 2.3 Semi-synthetic ribonuclease S: cyanylated homocysteine at position 13
1CJR 1999-05-07 2.3 X-RAY CRYSTALLOGRAPHIC STUDIES OF DENATURATION IN RIBONUCLEASE S
1J82 2001-06-06 2.3 Osmolyte Stabilization of RNase
6QMN 2019-05-08 2.31 Crystal structure of a Ribonuclease A-Onconase chimera
1RCN 1994-09-30 2.32 CRYSTAL STRUCTURE OF THE RIBONUCLEASE A D(APTPAPAPG) COMPLEX : DIRECT EVIDENCE FOR EXTENDED SUBSTRATE RECOGNITION
3I7W 2009-08-04 2.35 High pressure structure of wild-type RNase A (0.67 GPa)
2W5I 2009-02-17 2.4 RNASE A-AP3A COMPLEX
3I7Y 2009-08-04 2.4 High pressure structure of I106A variant of RNase A (0.48 GPa)
3OQZ 2010-10-20 2.5 Semi-synthetic ribonuclease S: meta-cyano-phenylalanine at position 8
2P47 2008-03-11 2.5 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 2.5A resolution: SE5B-TRI crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
2P46 2008-03-11 2.5 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 2.5A resolution: se5b-ortho-2 crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
1RTA 1993-10-31 2.5 CRYSTAL STRUCTURE DISPOSITION OF THYMIDYLIC ACID TETRAMER IN COMPLEX WITH RIBONUCLEASE A
1DFJ 1997-01-11 2.5 RIBONUCLEASE INHIBITOR COMPLEXED WITH RIBONUCLEASE A
1RBB 1988-07-16 2.5 THE CRYSTAL STRUCTURE OF RIBONUCLEASE B AT 2.5-ANGSTROMS RESOLUTION
1RTB 1993-10-31 2.5 CRYSTAL STRUCTURE DISPOSITION OF THYMIDYLIC ACID TETRAMER IN COMPLEX WITH RIBONUCLEASE A
3I7X 2009-08-04 2.6 High pressure structure of I106A RNase A variant (0.35 GPa)
1UN5 2004-02-06 2.6 ARH-II, AN ANGIOGENIN/RNASE A CHIMERA
6GOK 2018-07-25 2.65 X-ray structure of the adduct formed upon reaction of bovine pancreatic ribonuclease with a Pd(II) complex bearing N,N-pyridylbenzimidazole derivative with an alkylated sulphonate side chain
2E33 2007-03-20 2.7 Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
1RBJ 1995-12-07 2.7 RIBONUCLEASE B COMPLEX WITH D(TETRA-(DEOXY-ADENYLATE))
1BZQ 1998-11-11 2.8 COMPLEX OF A DROMEDARY SINGLE-DOMAIN VHH ANTIBODY FRAGMENT WITH RNASE A
1CJQ 1999-05-07 3.0 X-RAY CRYSTALLOGRAPHIC STUDIES OF THE DENATURATION OF THE DENATURATION OF RIBONUCLEASE S.

Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
96.0 Ribonuclease pancreatic Q29606 RNAS1_ORYLE
90.3 Ribonuclease pancreatic P00662 RNAS1_GIRCA
92.7 Ribonuclease pancreatic P00668 RNAS1_ANTAM
95.2 Ribonuclease pancreatic P00660 RNAS1_CONTA
93.5 Ribonuclease pancreatic P07848 RNAS1_EUDTH
96.0 Ribonuclease pancreatic P07847 RNAS1_AEPME
95.2 Ribonuclease pancreatic P00657 RNAS1_BUBBU
96.8 Ribonuclease pancreatic P67927 RNAS1_SHEEP
96.8 Ribonuclease pancreatic P67926 RNAS1_CAPHI
100.0 Ribonuclease pancreatic P61823 RNAS1_BOVIN
100.0 Ribonuclease pancreatic P61824 RNAS1_BISBI