In a previous paper (Ramsay and Eftink, Biophys. J. 66:516-523) we reported the development of a modified spectrophotometer that can make nearly simultaneous circular dichroism (CD) and fluorescence measurements. This arrangement allows multiple data sets to be collected during a single experiment, resulting in a saving of time and material, and improved correlation between the different types of measurements. The usefulness of the instrument was shown by thermal melting experiments on several different protein systems. This CD/fluorometer spectrophotometer has been further modified by interfacing with a syringe pump and a pH meter. This arrangement allows ligand, pH, and chemical denaturation titration experiments to be performed while monitoring changes in the sample's CD, absorbance, fluorescence, and light scattering properties. Our data acquisition program also has an ability to check whether the signals have approached equilibrium before the data is recorded. For performing pH titrations we have developed a procedure which uses the signal from a pH meter in a feedback circuit in order to collect data at evenly spaced pH intervals. We demonstrate the use of this instrument with studies of the unfolding of sperm whale apomyoglobin, as induced by acid pH and by the addition of guanidine-HCI. Study holds ProTherm entries: 7408, 7409, 7410, 7411 Extra Details: the transition is from native to intermediate thermal melting experiment; ligand; chemical denaturation;,data acquisition program
ID: ariYMUGp
Submitter: Connie Wang
Submission Date: April 24, 2018, 8:34 p.m.
Version: 1
Number of data points | 12 |
Proteins | Myoglobin ; Myoglobin |
Unique complexes | 1 |
Assays/Quantities/Protocols | Experimental Assay: Cm ; Experimental Assay: m ; Experimental Assay: dG_H2O ; Experimental Assay: Cm ; Experimental Assay: m ; Experimental Assay: dG_H2O |
Libraries | Mutations for sequence VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG |
Colors: | D | E | R | H | K | S | T | N | Q | A | V | I | L | M | F | Y | W | C | G | P |
---|
Percent Identity | Matching Chains | Protein | Accession | Entry Name |
---|---|---|---|---|
100.0 | Myoglobin | P02185 | MYG_PHYMC | |
96.8 | Myoglobin | Q0KIY5 | MYG_KOGBR | |
96.8 | Myoglobin | P02184 | MYG_KOGSI | |
92.9 | Myoglobin | Q0KIY1 | MYG_BALBO | |
92.9 | Myoglobin | Q0KIY2 | MYG_BALED | |
92.9 | Myoglobin | P02177 | MYG_ESCRO | |
92.2 | Myoglobin | P02178 | MYG_MEGNO | |
91.4 | Myoglobin | Q0KIY3 | MYG_PENEL | |
91.4 | Myoglobin | P02181 | MYG_INIGE | |
92.1 | Myoglobin | P02174 | MYG_GLOME | |
90.9 | Myoglobin | P02179 | MYG_BALAC | |
91.4 | Myoglobin | P02173 | MYG_ORCOR | |
90.8 | Myoglobin | Q0KIY7 | MYG1_STEAT | |
90.8 | Myoglobin | P68276 | MYG_DELDE | |
90.8 | Myoglobin | P68279 | MYG_TURTR | |
90.8 | Myoglobin | P68277 | MYG_PHODA | |
90.8 | Myoglobin | P68278 | MYG_PHOPH | |
90.3 | Myoglobin | P02180 | MYG_BALPH | |
90.1 | Myoglobin | P02183 | MYG_MESCA | |
90.1 | Myoglobin | Q0KIY0 | MYG_MESST | |
90.1 | Myoglobin | P02182 | MYG_ZIPCA |