Arc repressor mutants containing from three to 15 multiple-alanine substitutions have spectral properties expected for native Arc proteins, form heterodimers with wild-type Arc, denature cooperatively with Tms equal to or greater than wild type, and, in some cases, fold as much as 30-fold faster and unfold as much as 50-fold slower than wild type. Two of the mutants, containing a total of 14 different substitutions, also footprint operator DNA in vitro. The stability of some of the proteins with multiple-alanine mutations is significantly greater than that predicted from the sum of the single substitutions, suggesting that a subset of the wild-type residues in Arc may interact in an unfavorable fashion. Overall, these results show that almost half of the residues in Arc can be replaced by alanine en masse without compromising the ability of this small, homodimeric protein to fold into a stable, native-like structure. Study holds ProTherm entries: 6494, 6495, 6496, 6497, 6498, 6499, 6500, 6501, 6502 Extra Details: additive : EDTA(0.2 M), hyper-stable mutants; fast-folding mutants;,operator-DNA binding; heterodimer formation; nonadditivity
ID: ZxyWKSzF
Submitter: Connie Wang
Submission Date: April 24, 2018, 8:32 p.m.
Version: 1
Number of data points | 9 |
Proteins | Transcriptional repressor arc ; Transcriptional repressor arc |
Unique complexes | 6 |
Assays/Quantities/Protocols | Experimental Assay: dG ; Experimental Assay: Tm |
Libraries | Mutations for sequence MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA |
Colors: | D | E | R | H | K | S | T | N | Q | A | V | I | L | M | F | Y | W | C | G | P |
---|
Percent Identity | Matching Chains | Protein | Accession | Entry Name |
---|---|---|---|---|
100.0 | Transcriptional repressor arc | P03050 | RARC_BPP22 |