Direct observation of fast protein folding: the initial collapse of apomyoglobin.

Abstract

The rapid refolding dynamics of apomyoglobin are followed by a new temperature-jump fluorescence technique on a 15-ns to 0.5-ms time scale in vitro. The apparatus measures the protein-folding history in a single sweep in standard aqueous buffers. The earliest steps during folding to a compact state are observed and are complete in under 20 micros. Experiments on mutants and consideration of steady-state CD and fluorescence spectra indicate that the observed microsecond phase monitors assembly of an A x (H x G) helix subunit. Measurements at different viscosities indicate diffusive behavior even at low viscosities, in agreement with motions of a solvent-exposed protein during the initial collapse. Study holds ProTherm entries: 8650 Extra Details: molten globule; temperature jump; fluorescence; circular dichroism

Submission Details

ID: VVhviJYA3

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:36 p.m.

Version: 1

Publication Details
Ballew RM;Sabelko J;Gruebele M,Proc. Natl. Acad. Sci. U.S.A. (1996) Direct observation of fast protein folding: the initial collapse of apomyoglobin. PMID:8650166
Additional Information

Study Summary

Number of data points 3
Proteins Myoglobin ; Myoglobin
Unique complexes 1
Assays/Quantities/Protocols Experimental Assay: dCp ; Experimental Assay: Tm ; Experimental Assay: dHvH
Libraries Mutations for sequence GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
100.0 Myoglobin P68083 MYG_EQUBU
100.0 Myoglobin P68082 MYG_HORSE
91.6 Myoglobin P02181 MYG_INIGE
92.2 Myoglobin P02169 MYG_LEPMU
90.9 Myoglobin P02166 MYG_PERPO
90.9 Myoglobin P02189 MYG_PIG
90.8 Myoglobin Q0KIY1 MYG_BALBO
90.8 Myoglobin Q0KIY2 MYG_BALED
90.8 Myoglobin P02177 MYG_ESCRO
90.3 Myoglobin P02183 MYG_MESCA
90.3 Myoglobin Q0KIY0 MYG_MESST
90.3 Myoglobin P02167 MYG_NYCCO
90.3 Myoglobin P02165 MYG_TUPGL
90.9 Myoglobin P11343 MYG_LUTLU
90.3 Myoglobin P02163 MYG_ROUAE
90.1 Myoglobin P02178 MYG_MEGNO