Diffusional barrier crossing in a two-state protein folding reaction.
Abstract
There has been some debate as to whether protein folding involves diffusive chain motions and thus depends on solvent viscosity. The interpretation of folding kinetics in viscous solvents has remained difficult and controversial, in that viscogenic agents affect folding rates not only by increasing solvent viscosity but also by increasing protein stability. By carefully choosing experimental conditions, we can now eliminate the effect on stability and show that the folding dynamics of the cold shock protein CspB are viscosity dependent. Thus Kramers' theory of reaction rates rather than transition state theory should be used to describe this folding reaction. Study holds ProTherm entries: 15082, 15083, 15084, 15085, 15086, 15087, 15088, 15089, 15090 Extra Details: diffusive chain motions; CspB; viscosity dependent
Submission Details
ID: Umz5HNLu3
Submitter: Connie Wang
Submission Date: April 24, 2018, 8:45 p.m.
Version: 1
Publication Details
Jacob M;Geeves M;Holtermann G;Schmid FX,Nat. Struct. Biol. (1999) Diffusional barrier crossing in a two-state protein folding reaction. PMID:10504725Additional Information
Study Summary
| Number of data points | 18 |
| Proteins | Cold shock protein CspB ; Cold shock protein CspB |
| Unique complexes | 1 |
| Assays/Quantities/Protocols | Experimental Assay: Tm ; Experimental Assay: dHvH |
| Libraries | Mutations for sequence MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA |
Structure view and single mutant data analysis
Study data
| Colors: | D | E | R | H | K | S | T | N | Q | A | V | I | L | M | F | Y | W | C | G | P |
|---|
Data Distribution
Studies with similar sequences (approximate matches)