An extensive thermodynamic characterization of the dimerization domain of the HIV-1 capsid protein.


Abstract

The type 1 human immunodeficiency virus presents a conical capsid formed by several hundred units of the capsid protein, CA. Homodimerization of CA occurs via its C-terminal domain, CA-C. This self-association process, which is thought to be pH-dependent, seems to constitute a key step in virus assembly. CA-C isolated in solution is able to dimerize. An extensive thermodynamic characterization of the dimeric and monomeric species of CA-C at different pHs has been carried out by using fluorescence, circular dichroism (CD), absorbance, nuclear magnetic resonance (NMR), Fourier transform infrared (FTIR), and size-exclusion chromatography (SEC). Thermal and chemical denaturation allowed the determination of the thermodynamic parameters describing the unfolding of both CA-C species. Three reversible thermal transitions were observed, depending on the technique employed. The first one was protein concentration-dependent; it was observed by FTIR and NMR, and consisted of a broad transition occurring between 290 and 315 K; this transition involves dimer dissociation. The second transition (Tm approximately 325 K) was observed by ANS-binding experiments, fluorescence anisotropy, and near-UV CD; it involves partial unfolding of the monomeric species. Finally, absorbance, far-UV CD, and NMR revealed a third transition occurring at Tm approximately 333 K, which involves global unfolding of the monomeric species. Thus, dimer dissociation and monomer unfolding were not coupled. At low pH, CA-C underwent a conformational transition, leading to a species displaying ANS binding, a low CD signal, a red-shifted fluorescence spectrum, and a change in compactness. These features are characteristic of molten globule-like conformations, and they resemble the properties of the second species observed in thermal unfolding. Study holds ProTherm entries: 19063, 19064, 19065, 19066, 19067, 19068, 19069, 19070, 19071, 19072, 19073, 19074, 19075, 19076, 19077, 19078, 19079, 19080, 19081, 19082, 19083, 19084, 19085, 19086, 19087, 19088, 19089, 19090, 19091, 19092, 19093, 19094, 19095, 19096, 19097, 19098, 19099, 19100, 19101, 19102, 19103 Extra Details: circular dichroism; chemical denaturation; fluorescence; NMR; protein stability; thermal denaturation

Submission Details

ID: QremtA4D3

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:51 p.m.

Version: 1

Publication Details
Lidón-Moya MC;Barrera FN;Bueno M;Pérez-Jiménez R;Sancho J;Mateu MG;Neira JL,Protein Sci. (2005) An extensive thermodynamic characterization of the dimerization domain of the HIV-1 capsid protein. PMID:16131662
Additional Information

Study Summary

Number of data points 41
Proteins Gag-Pol polyprotein ; Capsid protein VP24
Unique complexes 1
Assays/Quantities/Protocols Experimental Assay: Tm buffers:phosphate: 25 mM, pH:7.0 ; Experimental Assay: Tm pH:3.0, buffers:acetate: 25 mM ; Experimental Assay: Tm prot_conc:4500 microM, buffers:Sodium acetate: 10 mM, ionic:NaCl: 0.1 M, details:Additives EDTA ( ; Experimental Assay: Tm buffers:Sodium acetate: 10 mM, ionic:NaCl: 0.1 M, prot_conc:2000 microM, details:Additives EDTA ( ; Experimental Assay: Tm buffers:Sodium acetate: 10 mM, prot_conc:1100 microM, ionic:NaCl: 0.1 M, details:Additives EDTA ( ; Experimental Assay: Tm buffers:Sodium acetate: 10 mM, ionic:NaCl: 0.1 M, prot_conc:530 microM, details:Additives EDTA (0 ; Experimental Assay: Tm buffers:Sodium acetate: 10 mM, pH:8.0, ionic:NaCl: 0.1 M, prot_conc:1000 microM, details:Additive ; Experimental Assay: Tm buffers:Sodium acetate: 10 mM, ionic:NaCl: 0.1 M, prot_conc:1000 microM, details:Additives EDTA ( ; Experimental Assay: Tm buffers:Sodium acetate: 10 mM, pH:6.0, ionic:NaCl: 0.1 M, prot_conc:1000 microM, details:Additive ; Experimental Assay: Tm buffers:Unknown: , pH:9.0 ; Experimental Assay: Tm buffers:Unknown: , pH:8.0 ; Experimental Assay: Tm pH:5.0, buffers:Unknown: ; Experimental Assay: Tm buffers:Unknown: , pH:4.0 ; Experimental Assay: Tm buffers:Unknown: , pH:9.0 ; Experimental Assay: Tm pH:6.0, buffers:Unknown: ; Experimental Assay: Tm pH:5.0, buffers:Unknown: ; Experimental Assay: Tm pH:4.0, buffers:Unknown: ; Experimental Assay: Tm prot_conc:20 microM, buffers:Unknown: , pH:9.0 ; Experimental Assay: Tm pH:6.0, prot_conc:20 microM, buffers:Unknown: ; Experimental Assay: Tm prot_conc:20 microM, buffers:Unknown: , pH:5.0 ; Experimental Assay: Tm prot_conc:20 microM, pH:4.0, buffers:Unknown: ; Experimental Assay: Tm buffers:Unknown: , pH:8.0 ; Experimental Assay: Tm buffers:Unknown: , pH:7.0 ; Experimental Assay: Tm prot_conc:20 microM, buffers:Unknown: , pH:8.0 ; Experimental Assay: Tm prot_conc:20 microM, buffers:Unknown: , pH:7.0 ; Experimental Assay: Tm buffers:Unknown: , pH:7.0 ; Experimental Assay: Tm prot_conc:20 microM, buffers:Unknown: , pH:7.0 ; Experimental Assay: Tm buffers:Unknown: , prot_conc:80 microM, pH:7.0, details:Additives dye (100 microM), ; Experimental Assay: Tm prot_conc:20 microM, buffers:Unknown: , pH:9.0, details:Additives dye (100 microM), ; Experimental Assay: Tm prot_conc:20 microM, buffers:Unknown: , pH:8.0, details:Additives dye (100 microM), ; Experimental Assay: Tm prot_conc:20 microM, buffers:Unknown: , pH:7.0, details:Additives dye (100 microM), ; Experimental Assay: Tm pH:6.0, prot_conc:20 microM, buffers:Unknown: , details:Additives dye (100 microM), ; Experimental Assay: Tm buffers:Tris acid: , pH:9.0 ; Experimental Assay: Tm buffers:Tris acid: , pH:8.0 ; Experimental Assay: Tm buffers:Monosodium dihydrogen phosphate: , pH:7.0 ; Experimental Assay: Tm pH:6.0, buffers:Monosodium dihydrogen phosphate: ; Experimental Assay: Tm pH:5.0, buffers:Acetic acid:
Libraries Mutations for sequence MSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant PDB Entries

Structure ID Release Date Resolution Structure Title
2HMX 1996-01-29 HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 MATRIX PROTEIN
1HVN 1994-01-31 ZINC-AND SEQUENCE-DEPENDENT BINDING TO NUCLEIC ACIDS BY THE N-TERMINAL ZINC FINGER DOMAIN OF THE HIV-1 NUCLEOCAPSID PROTEIN: NMR STRUCTURE OF THE COMPLEX WITH THE PSI-SITE ANALOG, D/ACGCC
2L45 2011-12-14 C-terminal zinc knuckle of the HIVNCp7 with DNA
1ESK 2000-04-26 SOLUTION STRUCTURE OF NCP7 FROM HIV-1
5T82 2017-01-18 HIV-1 reverse transcriptase thumb subdomain
2M8L 2013-11-20 HIV capsid dimer structure
2JZW 2009-01-13 How the HIV-1 nucleocapsid protein binds and destabilises the (-)primer binding site during reverse transcription
1NCP 1993-10-31 STRUCTURAL CHARACTERIZATION OF A 39 RESIDUE SYNTHETIC PEPTIDE CONTAINING THE TWO ZINC BINDING DOMAINS FROM THE HIV-1 P7 NUCLEOCAPSID PROTEIN BY CD AND NMR SPECTROSCOPY
2M8N 2013-11-20 HIV-1 capsid monomer structure
2L4L 2010-12-08 Structural insights into the cTAR DNA recognition by the HIV-1 Nucleocapsid protein: role of sugar deoxyriboses in the binding polarity of NC
1HVO 1994-01-31 ZINC-AND SEQUENCE-DEPENDENT BINDING TO NUCLEIC ACIDS BY THE N-TERMINAL ZINC FINGER DOMAIN OF THE HIV-1 NUCLEOCAPSID PROTEIN: NMR STRUCTURE OF THE COMPLEX WITH THE PSI-SITE ANALOG, D/ACGCC
1TAM 1996-07-11 HUMAN IMMUNODEFICIENCY VIRUS, NMR, MINIMIZED AVERAGE STRUCTURE
2LYA 2013-02-13 Structure of HIV-1 myr(-) matrix protein in complex with 1,2-dioctanoyl-sn-phosphatidylcholine
2JPR 2007-10-09 Joint refinement of the HIV-1 CA-NTD in complex with the assembly inhibitor CAP-1
2JYL 2008-02-12 Solution Structure of A Double Mutant of The Carboxy-terminal Dimerization Domain of The HIV-1 Capsid Protein
1WJC 1998-05-13 SOLUTION STRUCTURE OF THE N-TERMINAL ZN BINDING DOMAIN OF HIV-1 INTEGRASE (E FORM), NMR, REGULARIZED MEAN STRUCTURE
2C55 2005-11-02 Solution Structure of the Human Immunodeficiency Virus Type 1 p6 Protein
2KOD 2009-11-24 A high-resolution NMR structure of the dimeric C-terminal domain of HIV-1 CA
1WJE 1998-12-16 SOLUTION STRUCTURE OF H12C MUTANT OF THE N-TERMINAL ZN BINDING DOMAIN OF HIV-1 INTEGRASE COMPLEXED TO CADMIUM, NMR, MINIMIZED AVERAGE STRUCTURE
2L46 2011-12-14 C-terminal zinc finger of the HIVNCp7 with platinated DNA
5I1R 2016-03-30 Quantitative characterization of configurational space sampled by HIV-1 nucleocapsid using solution NMR and X-ray scattering
2H3F 2006-07-25 Solution structure of the HIV-1 MA protein
3DIK 2008-09-16 Pseudo-atomic model of the HIV-1 CA hexameric lattice
2EXF 2007-04-24 Solution structure of the HIV-1 nucleocapsid (NCp7(12-55)) complexed with the DNA (-) Primer Binding Site
1WJF 1998-12-16 SOLUTION STRUCTURE OF H12C MUTANT OF THE N-TERMINAL ZN BINDING DOMAIN OF HIV-1 INTEGRASE COMPLEXED TO CADMIUM, NMR, 40 STRUCTURES
2H3Q 2006-07-25 Solution structure of HIV-1 myrMA bound to di-C4-phosphatidylinositol-(4,5)-bisphosphate
1WJA 1998-05-13 SOLUTION STRUCTURE OF THE N-TERMINAL ZN BINDING DOMAIN OF HIV-1 INTEGRASE (D FORM), NMR, REGULARIZED MEAN STRUCTURE
1AAF 1994-01-31 NUCLEOCAPSID ZINC FINGERS DETECTED IN RETROVIRUSES: EXAFS STUDIES ON INTACT VIRUSES AND THE SOLUTION-STATE STRUCTURE OF THE NUCLEOCAPSID PROTEIN FROM HIV-1
1U57 2005-02-08 NMR structure of the (345-392)Gag sequence from HIV-1
6N3U 2018-12-12 MicroED Structure of the CTD-SP1 fragment of HIV-1 Gag with bound maturation inhibitor Bevirimat.
2M8P 2013-11-20 The structure of the W184AM185A mutant of the HIV-1 capsid protein
2H3V 2006-07-25 Structure of the HIV-1 Matrix protein bound to di-C8-phosphatidylinositol-(4,5)-bisphosphate
1WJD 1998-05-13 SOLUTION STRUCTURE OF THE N-TERMINAL ZN BINDING DOMAIN OF HIV-1 INTEGRASE (E FORM), NMR, 38 STRUCTURES
1UPH 2004-01-08 HIV-1 Myristoylated Matrix
1WJB 1998-05-13 SOLUTION STRUCTURE OF THE N-TERMINAL ZN BINDING DOMAIN OF HIV-1 INTEGRASE (D FORM), NMR, 40 STRUCTURES
2LYB 2013-02-13 Structure of HIV-1 myr(-) matrix protein in complex with 1,2-dioctanoyl-sn-phosphatidyl-L-serine
2H3I 2006-07-25 Solution structure of the HIV-1 myristoylated Matrix protein
2LF4 2011-11-09 Structure of a monomeric mutant of the HIV-1 capsid protein
1MFS 1998-06-17 DYNAMICAL BEHAVIOR OF THE HIV-1 NUCLEOCAPSID PROTEIN; NMR, 30 STRUCTURES
1BVG 1996-08-17 HIV-1 PROTEASE-DMP323 COMPLEX IN SOLUTION, NMR MINIMIZED AVERAGE STRUCTURE
1GWP 2002-06-21 STRUCTURE OF THE N-TERMINAL DOMAIN OF THE MATURE HIV-1 CAPSID PROTEIN
5E5K 2016-05-04 Joint X-ray/neutron structure of HIV-1 protease triple mutant (V32I,I47V,V82I) with darunavir at pH 4.3
1BVE 1996-08-17 HIV-1 PROTEASE-DMP323 COMPLEX IN SOLUTION, NMR, 28 STRUCTURES
2M3Z 2013-02-27 NMR solution structure of HIV-1 nucleocapsid protein in complex with an inhibitor displaying a 2 inhibitors:1 NC stoichiometry
4JEC 2013-07-24 Joint neutron and X-ray structure of per-deuterated HIV-1 protease in complex with clinical inhibitor amprenavir
2H3Z 2006-07-25 Structure of the HIV-1 matrix protein bound to di-C4-phosphatidylinositol-(4,5)-bisphosphate
1O1W 2003-02-18 SOLUTION STRUCTURE OF THE RNASE H DOMAIN OF THE HIV-1 REVERSE TRANSCRIPTASE IN THE PRESENCE OF MAGNESIUM
1Q9P 2004-03-02 Solution structure of the mature HIV-1 protease monomer
1F6U 2000-10-09 NMR structure of the HIV-1 nucleocapsid protein bound to stem-loop sl2 of the psi-RNA packaging signal. Implications for genome recognition
1QMC 1999-12-14 C-terminal DNA-binding domain of HIV-1 integrase, NMR, 42 structures
5IRT 2016-06-22 Dimerization interface of the noncrystalline HIV-1 capsid protein lattice from solid state NMR spectroscopy of tubular assemblies
2JYG 2008-02-26 Solution Structure of the W184A/M185A Mutant of the Carboxy-terminal Dimerization Domain of the HIV-1 Capsid Protein
2L6E 2010-12-29 NMR Structure of the monomeric mutant C-terminal domain of HIV-1 Capsid in complex with stapled peptide Inhibitor
5YOK 2018-07-18 0.85 Structure of HIV-1 Protease in Complex with Inhibitor KNI-1657
3A2O 2010-03-02 0.88 Crystal Structure of HIV-1 Protease Complexed with KNI-1689
3FX5 2009-03-24 0.93 Structure of HIV-1 Protease in Complex with Potent Inhibitor KNI-272 Determined by High Resolution X-ray Crystallography
3DJK 2008-09-30 1.0 Wild Type HIV-1 Protease with potent Antiviral inhibitor GRL-0255A
3NU3 2010-08-25 1.02 Wild Type HIV-1 Protease with Antiviral Drug Amprenavir
3NDX 2011-07-20 1.03 HIV-1 Protease Saquinavir:Ritonavir 1:50 complex structure
1NH0 2004-04-13 1.03 1.03 A structure of HIV-1 protease: inhibitor binding inside and outside the active site
2J9J 2007-08-28 1.04 Atomic-resolution Crystal Structure of Chemically-Synthesized HIV-1 Protease Complexed with Inhibitor JG-365
3BVA 2008-04-01 1.05 Cystal structure of HIV-1 Active Site Mutant D25N and p2-NC analog inhibitor
3D20 2008-05-27 1.05 Crystal structure of HIV-1 mutant I54V and inhibitor DARUNAVIA
3D1Y 2008-05-27 1.05 Crystal structure of HIV-1 mutant I54V and inhibitor SAQUINA
3D1X 2008-06-03 1.05 Crystal structure of HIV-1 mutant I54M and inhibitor saquinavir
4HE9 2013-08-21 1.06 Crystal Structure of HIV-1 protease mutants I54M complexed with inhibitor GRL-0519
3DK1 2009-05-12 1.07 Wild Type HIV-1 Protease with potent Antiviral inhibitor GRL-0105A
2JE4 2007-08-28 1.07 Atomic-resolution crystal structure of chemically-synthesized HIV-1 protease in complex with JG-365
1KZK 2002-04-03 1.09 JE-2147-HIV Protease Complex
2AVS 2006-01-24 1.1 kinetics, stability, and structural changes in high resolution crystal structures of HIV-1 protease with drug resistant mutations L24I, I50V, and G73S
2AOG 2006-01-17 1.1 Crystal structure analysis of HIV-1 protease mutant V82A with a substrate analog P2-NC
2AVM 2006-01-24 1.1 Kinetics, stability, and structural changes in high resolution crystal structures of HIV-1 protease with drug resistant mutations L24I, I50V, AND G73S
4EJD 2013-05-01 1.1 HIV Protease (PR) dimer in closed form with pepstatin in active site and fragment 1F1 in the outside/top of flap
2AVO 2006-01-24 1.1 Kinetics, stability, and structural changes in high resolution crystal structures of HIV-1 protease with drug resistant mutations L24I, I50V, AND G73S
2QD7 2008-04-22 1.11 HIV-1 Protease Mutant V82A with potent Antiviral inhibitor GRL-98065
4ZIP 2015-07-15 1.11 HIV-1 wild Type protease with GRL-0648A (a isophthalamide-derived P2-Ligand)
3DS4 2008-09-02 1.12 HIV-1 capsid C-terminal domain mutant (L211S) in complex with an inhibitor of particle assembly (CAI)
3TOH 2012-08-15 1.12 HIV-1 Protease - Epoxydic Inhibitor Complex (pH 9 - Orthorombic Crystal form P212121)
3NDW 2011-07-20 1.14 HIV-1 Protease Saquinavir:Ritonavir 1:15 complex structure
6DV4 2018-10-31 1.14 HIV-1 wild type protease with GRL-04315A, a tetrahydronaphthalene carboxamide with (R)-Boc-amine and (S)-hydroxyl functionalities as the P2 ligand
3NU6 2010-08-25 1.16 Crystal Structure of HIV-1 Protease Mutant I54M with Antiviral Drug Amprenavir
5JG1 2016-09-21 1.16 HIV-1 wild Type protease with GRL-031-14A (a Adamantane P1-Ligand with tetrahydropyrano-tetrahydrofuran in P2 and isobutylamine in P1')
3I6O 2009-09-29 1.17 Crystal structure of wild type HIV-1 protease with macrocyclic inhibitor GRL-0216A
4MC9 2014-04-02 1.19 HIV protease in complex with AA74
4FL8 2012-10-17 1.2 HIV-1 protease complexed with gem-diol-amine tetrahedral intermediate
5AGZ 2015-05-06 1.2 Disubstituted bis-THF moieties as new P2 ligands in non-peptidal HIV- 1 Protease Inhibitors (II)
3CYX 2008-05-27 1.2 Crystal structure of HIV-1 mutant I50V and inhibitor saquinavira
2R8N 2008-07-29 1.2 Structural Analysis of the Unbound Form of HIV-1 Subtype C Protease
3DS2 2008-09-02 1.2 HIV-1 capsid C-terminal domain mutant (Y169A)
2QCI 2008-04-22 1.2 HIV-1 Protease mutant D30N with potent Antiviral inhibitor GRL-98065
1K1T 2002-07-10 1.2 Combining Mutations in HIV-1 Protease to Understand Mechanisms of Resistance
3NU4 2010-08-25 1.2 Crystal Structure of HIV-1 Protease Mutant V32I with Antiviral Drug Amprenavir
2J9K 2007-08-28 1.2 Atomic-resolution Crystal Structure of Chemically-Synthesized HIV-1 Protease Complexed with Inhibitor MVT-101
6DIF 2018-10-17 1.2 Wild-type HIV-1 protease in complex with tipranavir
6DV0 2018-10-31 1.2 HIV-1 wild type protease with GRL-02815A, a thiochroman heterocycle with (S)-Boc-amine functionality as the P2 ligand
1T3R 2005-05-03 1.2 HIV protease wild-type in complex with TMC114 inhibitor
4HDP 2013-08-14 1.22 Crystal Structure of HIV-1 protease mutants I50V complexed with inhibitor GRL-0519
6E9A 2018-11-07 1.22 HIV-1 WILD TYPE PROTEASE WITH GRL-034-17A, (3aS, 5R, 6aR)-2-OXOHEXAHYD CYCLOPENTA[D]-5-OXAZOLYL URETHANE WITH A BICYCLIC OXAZOLIDINONE SCAFF AS THE P2 LIGAND
5DGU 2015-10-28 1.22 Crystal Structure of HIV-1 Protease Inhibitors Containing Substituted fused-Tetrahydropyranyl Tetrahydrofuran as P2-Ligand GRL-004-11A
2F8G 2006-03-07 1.22 HIV-1 protease mutant I50V complexed with inhibitor TMC114
4DFG 2012-03-21 1.23 Crystal Structure of Wild-type HIV-1 Protease with Cyclopentyltetrahydro- furanyl Urethanes as P2-ligand, GRL-0249A
3TOG 2012-08-15 1.24 HIV-1 Protease - Epoxydic Inhibitor Complex (pH 9 - Monoclinic Crystal form P21)
3VF5 2012-11-21 1.25 Crystal Structure of HIV-1 Protease Mutant I47V with novel P1'-Ligands GRL-02031
1SDU 2004-05-25 1.25 Crystal structures of HIV protease V82A and L90M mutants reveal changes in indinavir binding site.
3NDU 2011-07-20 1.25 HIV-1 Protease Saquinavir:Ritonavir 1:5 complex structure
2F81 2006-03-07 1.25 HIV-1 Protease mutant L90M complexed with inhibitor TMC114
6DJ1 2018-10-17 1.26 Wild-type HIV-1 protease in complex with Lopinavir
5AH8 2015-05-06 1.26 Disubstituted bis-THF moieties as new P2 ligands in non-peptidal HIV- 1 Protease Inhibitors (II)
5UPZ 2017-05-10 1.27 HIV-1 wild Type protease with GRL-0518A , an isophthalamide-derived P2-P3 ligand with the para-hydoxymethyl sulfonamide isostere as the P2' group
3OK9 2010-09-22 1.27 Crystal structure of wild-type HIV-1 protease with new oxatricyclic designed inhibitor GRL-0519A
2QD6 2008-04-22 1.28 HIV-1 Protease Mutant I50V with potent Antiviral inhibitor GRL-98065
5BS4 2015-09-09 1.29 HIV-1 wild Type protease with GRL-047-11A (a methylamine bis-Tetrahydrofuran P2-Ligand, 4-amino sulfonamide derivative)
3H5B 2009-06-16 1.29 Crystal structure of wild type HIV-1 protease with novel P1'-ligand GRL-02031
3NU5 2010-08-25 1.29 Crystal Structure of HIV-1 Protease Mutant I50V with Antiviral Drug Amprenavir
4HDF 2013-08-14 1.29 Crystal Structure of HIV-1 protease mutants V82A complexed with inhibitor GRL-0519
2AVQ 2006-01-24 1.3 Kinetics, stability, and structural changes in high resolution crystal structures of HIV-1 protease with drug resistant mutations L24I, I50V, AND G73S
3D1Z 2008-05-27 1.3 Crystal structure of HIV-1 mutant I54M and inhibitor DARUNAVIR
1SDT 2004-05-25 1.3 Crystal structures of HIV protease V82A and L90M mutants reveal changes in indinavir binding site.
2AOC 2006-01-17 1.3 Crystal structure analysis of HIV-1 protease mutant I84V with a substrate analog P2-NC
6E7J 2018-11-07 1.3 HIV-1 wild type protease with GRL-042-17A, 3-phenylhexahydro-2h-cyclopenta[d]oxazol-2-one with a bicyclic oxazolidinone scaffold as the P2 ligand
4DQE 2012-03-07 1.3 Crystal Structure of (G16C/L38C) HIV-1 Protease in Complex with DRV
4U8W 2014-11-05 1.3 HIV-1 wild Type protease with GRL-050-10A (a Gem-difluoro-bis-Tetrahydrofuran as P2-Ligand)
3VF7 2012-11-21 1.3 Crystal Structure of HIV-1 Protease Mutant L76V with novel P1'-Ligands GRL-02031
2IEN 2006-10-03 1.3 Crystal structure analysis of HIV-1 protease with a potent non-peptide inhibitor (UIC-94017)
3KFR 2010-02-23 1.3 HIV Protease (PR) dimer with inhibitor TL-3 bound and fragment 1F1 in the outside/top of flap
3HAU 2011-04-27 1.3 Crystal structure of chemically synthesized HIV-1 protease with reduced isostere MVT-101 inhibitor
3BVB 2008-04-01 1.3 Cystal structure of HIV-1 Active Site Mutant D25N and inhibitor Darunavir
3HAW 2011-04-27 1.3 Crystal structure of [L-Ala51/51']HIV-1 protease with reduced isostere MVT-101 inhibitor
2A1E 2006-02-21 1.3 High resolution structure of HIV-1 PR with TS-126
4YHQ 2015-06-10 1.3 Crystal structure of multidrug resistant clinical isolate PR20 with GRL-5010A
4J55 2013-05-15 1.31 Crystal Structure of Multidrug Resistant HIV-1 Protease Clinical isolate PR20 with the potent antiviral inhibitor GRL-02031
4MC6 2014-04-02 1.31 HIV protease in complex with SA499
4FLG 2012-10-17 1.31 HIV-1 protease mutant I47V complexed with reaction intermediate
6DJ7 2018-10-17 1.31 HIV-1 protease with mutation L76V in complex with GRL-5010 (gem-difluoro-bis-tetrahydrofuran as P2 ligand)
2AOF 2006-01-17 1.32 Crystal structure analysis of HIV-1 Protease mutant V82A with a substrate analog P1-P6
3TL9 2012-04-25 1.32 crystal structure of HIV protease model precursor/Saquinavir complex
5UOV 2017-05-10 1.33 HIV-1 wild Type protease with GRL-1118A , an isophthalamide-derived P2-P3 ligand with the sulfonamide isostere as the P2' group
2O4L 2006-12-12 1.33 Crystal Structure of HIV-1 Protease (Q7K, I50V) in Complex with Tipranavir
5BRY 2015-09-09 1.34 HIV-1 wild Type protease with GRL-011-11A (a methylamine bis-Tetrahydrofuran P2-Ligand, sulfonamide isostere derivate)
3TH9 2011-09-28 1.34 Crystal Structure of HIV-1 Protease Mutant Q7K V32I L63I with a cyclic sulfonamide inhibitor
3NUO 2010-08-25 1.35 Crystal Structure of HIV-1 Protease Mutant L90M with Antiviral Drug Amprenavir
2QD8 2008-04-22 1.35 HIV-1 Protease Mutant I84V with potent Antiviral inhibitor GRL-98065
2BB9 2005-11-15 1.35 Structure of HIV1 protease and AKC4p_133a complex.
4YE3 2015-06-10 1.35 Crystal Structure of Multidrug Resistant HIV-1 Protease Clinical Isolate PR20 with Inhibitor GRL-4410A
1T7I 2005-05-10 1.35 The structural and thermodynamic basis for the binding of TMC114, a next-generation HIV-1 protease inhibitor.
5AHA 2015-05-06 1.35 Disubstituted bis-THF moieties as new P2 ligands in non-peptidal HIV- 1 Protease Inhibitors (II)
6DJ2 2018-10-17 1.36 HIV-1 protease with single mutation L76V in complex with Lopinavir
3TKG 2012-04-25 1.36 crystal structure of HIV model protease precursor/saquinavir complex
3UCB 2012-03-28 1.38 Crystal Structure of Multidrug Resistant HIV-1 Protease Clinical Isolate PR20 in Complex with Darunavir
3QN8 2012-02-08 1.38 HIV-1 protease (mutant Q7K L33I L63I) in complex with a novel inhibitor
4U1J 2015-04-08 1.38 HLA class I micropolymorphisms determine peptide-HLA landscape and dictate differential HIV-1 escape through identical epitopes
4U7V 2015-03-25 1.38 Structure of wild-type HIV protease in complex with degraded photosensitive inhibitor
3K4V 2010-06-09 1.39 New crystal form of HIV-1 Protease/Saquinavir structure reveals carbamylation of N-terminal proline
4MC1 2014-04-02 1.39 HIV protease in complex with SA526P
3QIH 2012-02-01 1.39 HIV-1 protease (mutant Q7K L33I L63I) in complex with a novel inhibitor
2XDE 2010-12-22 1.4 Crystal structure of the complex of PF-3450074 with an engineered HIV capsid N terminal domain
4FM6 2012-10-17 1.4 HIV-1 protease mutant V32I complexed with reaction intermediate
3KA2 2011-04-27 1.4 Crystal structure of chemically synthesized 203 amino acid 'covalent dimer' [L-Ala;Gly51']HIV-1 protease molecule complexed with MVT-101 reduced isostere inhibitor at 1.4 A resolution
2AOD 2006-01-17 1.4 Crystal structure analysis of HIV-1 protease with a substrate analog P2-NC
3QAA 2011-12-21 1.4 HIV-1 wild type protease with a substituted bis-Tetrahydrofuran inhibitor, GRL-044-10A
2AOI 2006-01-17 1.4 Crystal structure analysis of HIV-1 protease with a substrate analog P1-P6
1SDV 2004-05-25 1.4 Crystal structures of HIV protease V82A and L90M mutants reveal changes in indinavir binding site.
3QIO 2011-04-20 1.4 Crystal Structure of HIV-1 RNase H with engineered E. coli loop and N-hydroxy quinazolinedione inhibitor
3CYW 2008-05-27 1.4 Effect of Flap Mutations on Structure of HIV-1 Protease and Inhibition by Saquinavir and Darunavir
2QNP 2008-04-15 1.41 HIV-1 Protease in complex with a iodo decorated pyrrolidine-based inhibitor
2AOH 2006-01-17 1.42 Crystal structure analysis of HIV-1 Protease mutant V82A with a substrate analog P6-PR
3VFA 2012-11-21 1.43 Crystal Structure of HIV-1 Protease Mutant V82A with novel P1'-Ligands GRL-02031
5AH9 2015-05-06 1.44 Disubstituted bis-THF moieties as new P2 ligands in non-peptidal HIV- 1 Protease Inhibitors (II)
2FNT 2006-09-05 1.44 Crystal structure of a drug-resistant (V82A) inactive (D25N) HIV-1 protease complexed with AP2V variant of HIV-1 NC-p1 substrate.
3WNF 2013-12-25 1.45 Cyclic hexapeptide CKIDNC in complex with HIV-1 integrase
3QP0 2012-02-15 1.45 HIV-1 protease (mutant Q7K L33I L63I) in complex with a novel inhibitor
3ST5 2011-08-17 1.45 Crystal structure of wild-type HIV-1 protease with C3-Substituted Hexahydrocyclopentafuranyl Urethane as P2-Ligand, GRL-0489A
3NYG 2011-11-02 1.45 X-ray structure of ester chemical analogue [O-Gly51,O-Gly51']HIV-1 protease complexed with MVT-101 inhibitor
2F80 2006-03-07 1.45 HIV-1 Protease mutant D30N complexed with inhibitor TMC114
3QBF 2012-01-18 1.45 HIV-1 protease (mutant Q7K L33I L63I) in complex with a three-armed pyrrolidine-based inhibitor
3TOF 2012-08-15 1.45 HIV-1 Protease - Epoxydic Inhibitor Complex (pH 6 - Orthorombic Crystal form P212121)
3UFN 2012-03-28 1.45 Crystal Structure of Multidrug Resistant HIV-1 Protease Clinical Isolate PR20 in Complex with Saquinavir
3PWR 2011-04-20 1.45 HIV-1 Protease Mutant L76V complexed with Saquinavir
3O9I 2011-08-10 1.45 Crystal Structure of wild-type HIV-1 Protease in complex with af61
6B3F 2018-01-03 1.46 Crystal Structure of HIV Protease complexed with N-(3-fluoro-2-(2-((2S,5S)-5-methyl-1-(phenylsulfonyl)piperazin-2-yl)ethyl)phenyl)-3,3-bis(4-fluorophenyl)propanamide
3B7V 2007-12-18 1.46 HIV-1 protease complexed with gem-diol-amine tetrahedral intermediate NLLTQI
4HEG 2013-08-21 1.46 Crystal Structure of HIV-1 protease mutants R8Q complexed with inhibitor GRL-0519
3PWM 2011-04-20 1.46 HIV-1 Protease Mutant L76V with Darunavir
6DIL 2018-10-17 1.48 HIV-1 protease with single mutation L76V in complex with tipranavir
6B38 2018-01-03 1.48 Crystal Structure of HIV Protease complexed with N-(3-fluoro-2-(2-((2S,6R)-6-methyl-1-(phenylsulfonyl)piperazin-2-yl)ethyl)phenyl)-3,3-bis(4-fluorophenyl)propanamide
2QNN 2008-04-15 1.48 HIV-1 protease in complex with a multiple decorated pyrrolidine-based inhibitor
6MCR 2019-04-24 1.48 X-ray crystal structure of wild type HIV-1 protease in complex with GRL-001
4HDB 2013-08-14 1.49 Crystal Structure of HIV-1 protease mutants D30N complexed with inhibitor GRL-0519
5JFP 2016-09-21 1.49 HIV-1 wild Type protease with GRL-097-13A (a Adamantane P1-Ligand with bis-THF in P2 and isobutylamine in P1')
6B3G 2018-01-03 1.5 Crystal Structure of HIV Protease complexed with N-(3-fluoro-2-(2-((2S,6S)-6-methyl-1-(phenylsulfonyl)piperazin-2-yl)ethyl)phenyl)-3,3-bis(4-fluorophenyl)propanamide
4Q1Y 2015-02-18 1.5 Mutations Outside the Active Site of HIV-1 Protease Alter Enzyme Structure and Dynamic Ensemble of the Active Site to Confer Drug Resistance
5AHC 2015-05-06 1.5 Disubstituted bis-THF moieties as new P2 ligands in non-peptidal HIV- 1 Protease Inhibitors (II)
5YOJ 2018-07-11 1.5 Structure of A17 HIV-1 Protease in Complex with Inhibitor KNI-1657
3NWQ 2011-11-02 1.5 X-ray structure of ester chemical analogue [O-Ile50,O-Ile50']HIV-1 protease complexed with MVT-101
3B80 2007-12-18 1.5 HIV-1 protease mutant I54V complexed with gem-diol-amine intermediate NLLTQI
2PWR 2008-04-15 1.5 HIV-1 protease in complex with a carbamoyl decorated pyrrolidine-based inhibitor
3NUJ 2010-08-25 1.5 Crystal Structure of HIV-1 Protease Mutant I54V with Antiviral Drug Amprenavir
2FGV 2006-11-07 1.5 X-ray crystal structure of HIV-1 Protease T80N variant in complex with the inhibitor saquinavir used to explore the role of invariant Thr80 in HIV-1 protease structure, function, and viral infectivity.
4A6C 2012-05-09 1.5 Stereoselective Synthesis, X-ray Analysis, and Biological Evaluation of a New Class of Lactam Based HIV-1 Protease Inhibitors
3WNH 2013-12-25 1.5 Cyclic hexapeptide PKZDNv in complex with HIV-1 integrase
4NX4 2014-02-26 1.5 Re-refinement of CAP-1 HIV-CA complex
4DQB 2012-03-07 1.5 Crystal Structure of wild-type HIV-1 Protease in Complex with DRV
5AH6 2015-05-06 1.5 Disubstituted bis-THF moieties as new P2 ligands in non-peptidal HIV- 1 Protease Inhibitors (II)
1XL2 2005-06-07 1.5 HIV-1 Protease in complex with pyrrolidinmethanamine
5AHB 2015-05-06 1.5 Disubstituted bis-THF moieties as new P2 ligands in non-peptidal HIV- 1 Protease Inhibitors (II)
2AVV 2006-01-24 1.5 Kinetics, stability, and structural changes in high resolution crystal structures of HIV-1 protease with drug resistant mutations L24I, I50V, and G73S
4QJ6 2014-10-29 1.5 Crystal structure of inactive HIV-1 protease variant (I50V/A71V) in complex with p1-p6 substrate variant (L449F)
4G1Q 2013-02-06 1.51 Crystal structure of HIV-1 reverse transcriptase (RT) in complex with Rilpivirine (TMC278, Edurant), a non-nucleoside rt-inhibiting drug
6MCS 2019-04-24 1.52 X-ray crystal structure of wild type HIV-1 protease in complex with GRL-003
5ULT 2017-05-03 1.53 HIV-1 wild Type protease with GRL-100-13A (a Crown-like Oxotricyclic Core as the P2-Ligand with the sulfonamide isostere as the P2' group)
4ZLS 2015-07-15 1.53 HIV-1 wild Type protease with GRL-096-13A (a Boc-derivative P2-Ligand, 3,-5-dimethylbiphenyl P1-Ligand)
4QJA 2014-10-29 1.54 Crystal structure of inactive HIV-1 protease in complex with p1-p6 substrate variant (P453L)
2AOE 2006-01-17 1.54 crystal structure analysis of HIV-1 protease mutant V82A with a substrate analog CA-P2
3ZPT 2013-11-06 1.54 Design and Synthesis of P1-P3 Macrocyclic Tertiary Alcohol Comprising HIV-1 Protease Inhibitors
2O4S 2006-12-12 1.54 Crystal Structure of HIV-1 Protease (Q7K) in Complex with Lopinavir
4E43 2012-05-30 1.54 HIV protease (PR) dimer with acetate in exo site and peptide in active site
3VFB 2012-11-21 1.55 Crystal Structure of HIV-1 Protease Mutant N88D with novel P1'-Ligands GRL-02031
3ZPS 2013-11-06 1.55 Design and Synthesis of P1-P3 Macrocyclic Tertiary Alcohol Comprising HIV-1 Protease Inhibitors
5NMH 2017-11-15 1.55 HLA A02 presenting SLYNTIATL
2PQZ 2008-04-15 1.55 HIV-1 Protease in complex with a pyrrolidine-based inhibitor
4CPS 2014-12-17 1.55 Macrocyclic Transition-State Mimicking HIV-1 Protease Inhibitors Encompassing a Tertiary Alcohol
4J54 2013-05-15 1.55 Crystal Structure of Multidrug Resistant HIV-1 Protease Clinical isolate PR20 with the potent antiviral inhibitor GRL-0519A
1DAZ 2000-05-03 1.55 Structural and kinetic analysis of drug resistant mutants of HIV-1 protease
1K1U 2002-07-10 1.55 Combining Mutations in HIV-1 Protease to Understand Mechanisms of Resistance
3TKW 2012-04-25 1.55 Crystal structure of HIV protease model precursor/Darunavir complex
5AH7 2015-02-18 1.55 Disubstituted bis-THF moieties as new P2 ligands in non-peptidal HIV- 1 Protease Inhibitors (II)
4MC2 2014-04-02 1.56 HIV protease in complex with SA525P
2R43 2008-09-09 1.58 I50V HIV-1 protease in complex with an amino decorated pyrrolidine-based inhibitor
3QRS 2012-02-22 1.59 HIV-1 protease (mutant Q7K L33I L63I) in complex with a three-armed pyrrolidine-based inhibitor
4U1H 2015-04-08 1.59 HLA class I micropolymorphisms determine peptide-HLA landscape and dictate differential HIV-1 escape through identical epitopes
4COC 2014-06-04 1.59 HIV-1 capsid C-terminal domain mutant (Y169L)
2AOJ 2006-01-17 1.6 Crystal structure analysis of HIV-1 protease with a substrate analog P6-PR
3DS1 2008-09-02 1.6 HIV-1 capsid C-terminal domain mutant (E187A) in complex with an inhibitor of particle assembly (CAI)
3FSM 2010-01-05 1.6 CRYSTAL STRUCTURE OF A CHEMICALLY SYNTHESIZED 203 AMINO ACID 'COVALENT DIMER' [L-Ala51,D-Ala51'] HIV-1 PROTEASE MOLECULE
3JVY 2009-12-08 1.6 HIV-1 Protease Mutant G86A with DARUNAVIR
3BXS 2008-03-25 1.6 Crystal Structures Of Highly Constrained Substrate And Hydrolysis Products Bound To HIV-1 Protease. Implications For Catalytic Mechanism
2Z4O 2008-04-22 1.6 Wild Type HIV-1 Protease with potent Antiviral inhibitor GRL-98065
1EXQ 2000-11-03 1.6 CRYSTAL STRUCTURE OF THE HIV-1 INTEGRASE CATALYTIC CORE DOMAIN
3OUB 2011-03-30 1.6 MDR769 HIV-1 protease complexed with NC/p1 hepta-peptide
3DS0 2008-09-02 1.6 HIV-1 capsid C-terminal domain mutant (N183A) in complex with an inhibitor of particle assembly (CAI)
4G8I 2013-03-20 1.6 Crystal Structure of HLA B2705-KK10-L6M
3EKW 2009-09-01 1.6 Crystal structure of the inhibitor Atazanavir (ATV) in complex with a multi-drug resistance HIV-1 protease variant (L10I/G48V/I54V/V64I/V82A) Refer: FLAP+ in citation.
3EL9 2009-09-01 1.6 Crystal structure of atazanavir (ATV) in complex with a multidrug HIV-1 protease (V82T/I84V)
3OU4 2011-03-30 1.6 MDR769 HIV-1 protease complexed with TF/PR hepta-peptide
4G9D 2013-03-20 1.6 Crystal Structure of HLA B2705-KK10
3EL5 2009-09-01 1.6 Crystal structure of nelfinavir (NFV) complexed with a multidrug variant (ACT) (V82T/I84V) of HIV-1 protease
3BXR 2008-03-25 1.6 Crystal Structures Of Highly Constrained Substrate And Hydrolysis Products Bound To HIV-1 Protease. Implications For Catalytic Mechanism
3HLO 2011-07-27 1.6 Crystal structure of chemically synthesized 'covalent dimer' [Gly51/D-Ala51']HIV-1 protease
2O4K 2006-12-12 1.6 Crystal Structure of HIV-1 Protease (Q7K) in Complex with Atazanavir
6B3C 2018-01-03 1.6 Crystal Structure of HIV Protease complexed with N-(3-fluoro-2-(2-((2S,6R)-6-methyl-1-(phenylsulfonyl)piperazin-2-yl)ethyl)phenyl)-3,3-bis(4-fluorophenyl)propanamide
6C8X 2018-12-05 1.61 Wild-type HIV-1 protease in complex with a phenylboronic acid (P2') analog of darunavir
3IAW 2011-04-27 1.61 Crystal structure of a chemically synthesized 203 amino acid 'covalent dimer' [Gly51;Aib51']HIV-1 protease molecule complexed with MVT-101 reduced isostere inhibitor at 1.6 A resolution
3QPJ 2012-02-15 1.61 HIV-1 protease (mutant Q7K L33I L63I) in complex with a three-armed pyrrolidine-based inhibitor
3QRO 2012-02-22 1.62 HIV-1 protease (mutant Q7K L33I L63I) in complex with a three-armed pyrrolidine-based inhibitor
5DGW 2015-10-28 1.62 Crystal Structure of HIV-1 Protease Inhibitor GRL-105-11A Containing Substituted fused-Tetrahydropyranyl Tetrahydrofuran as P2-Ligand
6B3H 2018-01-03 1.62 Crystal Structure of HIV Protease complexed with N-(2-(2-((6R,9S)-2,2-dioxido-2-thia-1,7-diazabicyclo[4.3.1]decan-9-yl)ethyl)-3-fluorophenyl)-3,3-bis(4-fluorophenyl)propanamide
3UF3 2012-03-28 1.63 Crystal Structure of Multidrug Resistant HIV-1 Protease Clinical isolate PR20
6B36 2018-01-03 1.63 Crystal Structure of HIV Protease complexed with (S)-N-(3-fluoro-2-(2-(1-(phenylsulfonyl)piperazin-2-yl)ethyl)phenyl)-3,3-bis(4-fluorophenyl)propanamide
4IPY 2013-10-16 1.64 HIV capsid C-terminal domain
3CKT 2009-03-24 1.65 HIV-1 protease in complex with a dimethylallyl decorated pyrrolidine based inhibitor (orthorombic space group)
2ZGA 2009-02-03 1.65 HIV-1 protease in complex with a dimethylallyl decorated pyrrolidine based inhibitor (hexagonal space group)
2NPH 2006-12-19 1.65 Crystal structure of HIV1 protease in situ product complex
3OXX 2011-09-28 1.65 Crystal Structure of HIV-1 I50V, A71V Protease in Complex with the Protease Inhibitor Atazanavir
5UFZ 2018-01-10 1.65 HIV-1 Protease complexed with Inhibitor: (3R,3aS,6aR)-hexahydrofuro[2,3-b]furan-3-yl [(1S,2S)-1-(1-{[(4-aminophenyl)sulfonyl](2-methylpropyl)amino}cyclopropyl)-1-hydroxy-3-phenylpropan-2-yl]carbamate
3O9G 2011-08-10 1.65 Crystal Structure of wild-type HIV-1 Protease in complex with af53
4OBK 2014-11-26 1.65 Crystal structure of inactive HIV-1 protease in complex with the P1-P6 substrate variant (L449F/S451N)
2XXM 2011-10-12 1.65 Crystal structure of the HIV-1 capsid protein C-terminal domain in complex with a camelid VHH and the CAI peptide.
1ZPK 2006-04-25 1.65 Crystal structure of the complex of mutant HIV-1 protease (A71V, V82T, I84V) with a hydroxyethylamine peptidomimetic inhibitor BOC-PHE-PSI[R-CH(OH)CH2NH]-PHE-GLU-PHE-NH2
3KT2 2010-02-16 1.65 Crystal Structure of N88D mutant HIV-1 Protease
3KDB 2010-03-02 1.66 Crystal Structure of HIV-1 Protease (Q7K, L33I, L63I) in Complex with KNI-10006
5NMK 2017-11-15 1.66 HLA A02 presenting SLFNTIAVL
4QJ7 2014-10-29 1.67 Crystal structure of inactive HIV-1 protease variant (I50V/A71V) in complex with p1-p6 substrate variant (R452S)
6BZ2 2018-02-28 1.67 Crystal structure of wild-type HIV-1 protease with a novel HIV-1 inhibitor GRL-14213A of 6-5-5-ring fused crown-like tetrahydropyranofuran as the P2-ligand, a cyclopropylaminobenzothiazole as the P2'-ligand and 3,5-difluorophenylmethyl as the P1-ligand
4OBF 2014-11-26 1.68 Crystal Structure of Nelfinavir-Resistant, Inactive HIV-1 Protease Variant (D30N/N88D) in Complex with the p1-p6 substrate variant (S451N)
4EPJ 2012-06-06 1.69 Crystal Structure of inactive single chain wild-type HIV-1 Protease in Complex with the substrate p2-NC
2WHH 2009-12-01 1.69 HIV-1 protease tethered dimer Q-product complex along with nucleophilic water molecule
2BBB 2005-11-15 1.7 Structure of HIV1 protease and hh1_173_3a complex.
2BUO 2005-07-21 1.7 HIV-1 capsid C-terminal domain in complex with an inhibitor of particle assembly
3EL1 2009-09-01 1.7 Crystal Structure of wild-type HIV protease in complex with the inhibitor, Atazanavir
3OU3 2011-03-30 1.7 MDR769 HIV-1 protease complexed with PR/RT hepta-peptide
1B9F 1999-07-19 1.7 MOBILITY OF AN HIV-1 INTEGRASE ACTIVE SITE LOOP IS CORRELATED WITH CATALYTIC ACTIVITY
3I7E 2009-09-29 1.7 Co-crystal structure of HIV-1 protease bound to a mutant resistant inhibitor UIC-98038
1FFI 2001-06-01 1.7 STRUCTURAL IMPLICATIONS OF DRUG RESISTANT MUTANTS OF HIV-1 PROTEASE: HIGH RESOLUTION CRYSTAL STRUCTURES OF THE MUTANT PROTEASE/SUBSTRATE ANALOG COMPLEXES
3IXO 2010-03-02 1.7 Crystal Structure of uncomplexed HIV_1 Protease Subtype A
5JPA 2016-08-10 1.7 Hexameric HIV-1 CA H12Y mutant
3AVI 2012-02-15 1.7 Crystal structures of novel allosteric peptide inhibitors of HIV integrase in the LEDGF binding site
3AVG 2012-01-18 1.7 Crystal structures of novel allosteric peptide inhibitors of HIV integrase in the LEDGF binding site
3WNE 2013-12-25 1.7 Cyclic hexapeptide PKIDNG in complex with HIV-1 integrase
4CPT 2014-12-17 1.7 Macrocyclic Transition-State Mimicking HIV-1 Protease Inhibitors Encompassing a Tertiary Alcohol
4CPW 2014-12-17 1.7 Macrocyclic Transition-State Mimicking HIV-1 Protease Inhibitors Encompassing a Tertiary Alcohol
1K2B 2002-07-10 1.7 Combining Mutations in HIV-1 Protease to Understand Mechanisms of Resistance
3NLS 2011-09-07 1.7 Crystal Structure of HIV-1 Protease in Complex with KNI-10772
3O9F 2011-08-10 1.7 Crystal Structure of wild-type HIV-1 Protease in complex with kd27
4EQ0 2012-06-06 1.7 Crystal Structure of inactive single chain variant of HIV-1 Protease in Complex with the substrate p2-NC
1DIF 1996-03-08 1.7 HIV-1 PROTEASE IN COMPLEX WITH A DIFLUOROKETONE CONTAINING INHIBITOR A79285
4E91 2012-04-25 1.7 Crystal Structure of the N-Terminal Domain of HIV-1 Capsid in Complex With Inhibitor BD3
2WKZ 2009-12-15 1.7 HIV-1 Protease Inhibitors Containing a Tertiary Alcohol in the Transition-State Mimic with Improved Cell-Based Antiviral Activity
3AV9 2012-01-18 1.7 Crystal structures of novel allosteric peptide inhibitors of HIV integrase in the LEDGF binding site
3AVF 2012-01-18 1.7 Crystal structures of novel allosteric peptide inhibitors of HIV integrase in the LEDGF binding site
3I8W 2009-12-01 1.7 Crystal structure of a metallacarborane inhibitor bound to HIV protease
4U7Q 2015-03-25 1.7 Structure of wild-type HIV protease in complex with photosensitive inhibitor PDI-6
3OUA 2011-03-30 1.7 MDR769 HIV-1 protease complexed with p1/p6 hepta-peptide
1B9D 1999-07-19 1.7 MOBILITY OF AN HIV-1 INTEGRASE ACTIVE SITE LOOP IS CORRELATED WITH CATALYTIC ACTIVITY
4F75 2013-05-15 1.7 Crystal Structure of active HIV-1 Protease in Complex with the N terminal product of the substrate RH-IN
3AVJ 2012-01-18 1.7 Crystal structures of novel allosteric peptide inhibitors of HIV integrase in the LEDGF binding site
5JFU 2016-09-21 1.7 HIV-1 wild Type protease with GRL-007-14A (a Adamantane P1-Ligand with bis-THF in P2 and benzylamine in P1')
3AVA 2012-01-18 1.7 Crystal structures of novel allosteric peptide inhibitors of HIV integrase in the LEDGF binding site
3OTS 2011-03-30 1.7 MDR769 HIV-1 protease complexed with MA/CA hepta-peptide
5XOS 2017-06-14 1.7 Crystal structure of HLA-B35 in complex with a pepetide antigen
4AH9 2012-12-19 1.7 Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
3QIN 2011-04-20 1.7 Crystal Structure of HIV-1 RNase H p15 with engineered E. coli loop and pyrimidinol carboxylic acid inhibitor
3O9H 2011-08-10 1.7 Crystal Structure of wild-type HIV-1 Protease in complex with kd26
1A8O 1998-10-14 1.7 HIV CAPSID C-TERMINAL DOMAIN
3HBO 2010-05-26 1.71 Crystal structure of chemically synthesized [D-Ala51/51']HIV-1 protease
3OQD 2011-04-06 1.71 Crystal Structures of Multidrug-Resistant Clinical Isolate 769 HIV-1 Protease Variants
3OQ7 2011-04-06 1.71 Crystal Structures of Multidrug-Resistant Clinical Isolate 769 HIV-1 Protease Variants
4QAG 2014-06-04 1.71 Structure of a dihydroxycoumarin active-site inhibitor in complex with the RNASE H domain of HIV-1 reverse transcriptase
3NDT 2011-07-20 1.72 HIV-1 Protease Saquinavir:Ritonavir 1:1 complex structure
1XL5 2005-06-07 1.73 HIV-1 Protease in complex with amidhyroxysulfone
3QRM 2012-02-22 1.73 HIV-1 protease (mutant Q7K L33I L63I) in complex with a three-armed pyrrolidine-based inhibitor
1B6L 2000-01-07 1.75 HIV-1 PROTEASE COMPLEXED WITH MACROCYCLIC PEPTIDOMIMETIC INHIBITOR 4
3EKV 2009-09-01 1.75 Crystal structure of the wild type HIV-1 protease with the inhibitor, Amprenavir
3AVK 2012-01-18 1.75 Crystal structures of novel allosteric peptide inhibitors of HIV integrase in the LEDGF binding site
3OTY 2011-03-30 1.75 MDR769 HIV-1 protease complexed with RT/RH hepta-peptide
6DJ5 2018-10-17 1.75 HIV-1 protease with mutation L76V in complex with GRL-0519 (tris-tetrahydrofuran as P2 ligand)
1D4L 2000-10-11 1.75 HIV-1 PROTEASE COMPLEXED WITH A MACROCYCLIC PEPTIDOMIMETIC INHIBITOR
1MTR 1996-08-01 1.75 HIV-1 PROTEASE COMPLEXED WITH A CYCLIC PHE-ILE-VAL PEPTIDOMIMETIC INHIBITOR
2UXZ 2008-05-20 1.75 Two-Carbon-Elongated HIV-1 Protease Inhibitors with a Tertiary- Alcohol-Containing Transition-State Mimic
3WNG 2013-12-25 1.75 Cyclic hexapeptide PKIDNp in complex with HIV-1 integrase
4I8Z 2013-07-24 1.75 Crystal structure of wild type HIV-1 protease in complex with non-peptidic inhibitor, GRL008
4OBJ 2014-11-26 1.75 Crystal Structure of Inactive HIV-1 Protease in Complex with the p1-p6 substrate variant (S451N)
4AHS 2012-12-19 1.75 Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
3BHE 2008-12-09 1.75 HIV-1 protease in complex with a three armed pyrrolidine derivative
5HRN 2016-12-14 1.75 HIV Integrase Catalytic Domain containing F185K mutation complexed with GSK0002
3OXV 2011-09-28 1.75 Crystal Structure of HIV-1 I50V, A71 Protease in Complex with the protease inhibitor amprenavir.
5YRS 2018-03-07 1.76 X-ray Snapshot of HIV-1 Protease in Action: Observation of Tetrahedral Intermediate and Its SIHB with Catalytic Aspartate
3OY4 2011-02-09 1.76 Crystal Structure of HIV-1 L76V Protease in Complex with the Protease Inhibitor Darunavir.
2UY0 2008-05-20 1.76 Two-Carbon-Elongated HIV-1 Protease Inhibitors with a Tertiary- Alcohol-Containing Transition-State Mimic
3LZU 2010-08-11 1.76 Crystal Structure of a Nelfinavir Resistant HIV-1 CRF01_AE Protease variant (N88S) in Complex with the Protease Inhibitor Darunavir.
5JL4 2017-10-04 1.76 Inhibitor resistant mutant catalytic core domain of HIV-1 Integrase
3AVC 2012-01-18 1.77 Crystal structures of novel allosteric peptide inhibitors of HIV integrase in the LEDGF binding site
3KFP 2010-02-23 1.77 HIV Protease (PR) with inhibitor TL-3 bound, and DMSOs in exo site
4U0C 2014-11-12 1.77 Hexameric HIV-1 CA in complex with Nup153 peptide, P6 crystal form
3KFN 2010-02-23 1.77 HIV Protease (PR) with inhibitor TL-3 and fragment hit 4D9 by soaking
1FEJ 2001-06-01 1.78 STRUCTURAL IMPLICATIONS OF DRUG RESISTANT MUTANTS OF HIV-1 PROTEASE: HIGH RESOLUTION CRYSTAL STRUCTURES OF THE MUTANT PROTEASE/SUBSTRATE ANALOG COMPLEXES
4OBG 2014-11-26 1.78 Crystal Structure of Nelfinavir-Resistant, Inactive HIV-1 Protease (D30N/N88D) in Complex with the p1-p6 substrate.
2PWC 2008-04-15 1.78 HIV-1 protease in complex with a amino decorated pyrrolidine-based inhibitor
4Q5M 2015-04-08 1.79 D30N tethered HIV-1 protease dimer/saquinavir complex
4GB2 2013-07-31 1.79 HIV-1 protease (mutant Q7K L33I L63I) in complex with a bicyclic pyrrolidine inhibitor
1EC0 2002-06-26 1.79 HIV-1 protease in complex with the inhibitor bea403
4DQH 2012-03-07 1.79 Crystal Structure of (R14C/E65C) HIV-1 Protease in complex with DRV
4EJK 2013-05-01 1.79 HIV Protease (PR) dimer in closed form with pepstatin in active site and fragment 1F1-N in the outside/top of flap
1PRO 1996-08-17 1.8 HIV-1 PROTEASE DIMER COMPLEXED WITH A-98881
5VCK 2018-04-18 1.8 HIV Protease (PR) with TL-3 in the active site and (Z)-N-(thiazol-2-yl)-N'-tosylcarbamimidate in the exosite
3EKY 2009-09-01 1.8 Crystal Structure of wild-type HIV protease in complex with the inhibitor, Atazanavir
1QBS 1997-10-15 1.8 HIV-1 PROTEASE INHIBITORS WIIH LOW NANOMOLAR POTENCY
3GGU 2009-08-11 1.8 HIV PR drug resistant patient's variant in complex with darunavir
1HVL 1994-04-30 1.8 INFLUENCE OF STEREOCHEMISTRY ON ACTIVITY AND BINDING MODES FOR C2 SYMMETRY-BASED DIOL INHIBITORS OF HIV-1 PROTEASE
4EQJ 2012-06-06 1.8 Crystal Structure of inactive single chain variant of HIV-1 Protease in Complex with the substrate RT-RH
3KF0 2010-02-23 1.8 HIV Protease with fragment 4D9 bound
3NF7 2011-04-27 1.8 Structural basis for a new mechanism of inhibition of HIV integrase identified by fragment screening and structure based design
1W5V 2004-12-01 1.8 HIV-1 protease in complex with fluoro substituted diol-based C2- symmetric inhibitor
4E92 2012-04-25 1.8 Crystal Structure of the N-Terminal Domain of HIV-1 Capsid in Complex With Inhibitor BM4
1HXW 1998-02-04 1.8 HIV-1 PROTEASE DIMER COMPLEXED WITH A-84538
5KAO 2016-08-31 1.8 Crystal structure of wild type HIV-1 protease in complex with GRL-10413
1SP5 2005-07-19 1.8 Crystal structure of HIV-1 protease complexed with a product of autoproteolysis
3BGC 2008-09-02 1.8 HIV-1 protease in complex with a benzyl decorated oligoamine
1G35 2001-06-06 1.8 CRYSTAL STRUCTURE OF HIV-1 PROTEASE IN COMPLEX WITH INHIBITOR, AHA024
3GI0 2011-08-10 1.8 Crystal structure of a chemically synthesized 203 amino acid 'covalent dimer' [l-ala51,d-ala51'] hiv-1 protease molecule complexed with jg-365 inhibitor
3AO2 2011-03-16 1.8 Fragment-based approach to the design of ligands targeting a novel site on HIV-1 integrase
2QI4 2008-04-22 1.8 Crystal structure of protease inhibitor, MIT-2-AD93 in complex with wild type HIV-1 protease
6AOC 2018-08-08 1.8 Crystal Structure of an N-Hydroxythienopyrimidine-2,4-dione RNase H Active Site Inhibitor with Multiple Binding Modes to HIV Reverse Transcriptase
2R3T 2008-09-02 1.8 I50V HIV-1 protease mutant in complex with a carbamoyl decorated pyrrolidine-based inhibitor
4K4Q 2013-09-18 1.8 TL-3 inhibited Trp6Ala HIV Protease with 3-bromo-2,6-dimethoxybenzoic acid bound in flap site
3KT5 2010-02-16 1.8 Crystal Structure of N88S mutant HIV-1 Protease
3OU1 2011-03-30 1.8 MDR769 HIV-1 protease complexed with RH/IN hepta-peptide
1HVR 1995-01-26 1.8 RATIONAL DESIGN OF POTENT, BIOAVAILABLE, NONPEPTIDE CYCLIC UREAS AS HIV PROTEASE INHIBITORS
1BWB 1998-09-30 1.8 HIV-1 PROTEASE (V82F/I84V) DOUBLE MUTANT COMPLEXED WITH SD146 OF DUPONT PHARMACEUTICALS
3HDK 2010-04-28 1.8 Crystal structure of chemically synthesized [Aib51/51']HIV-1 protease
2FXE 2007-02-20 1.8 X-ray crystal structure of HIV-1 protease CRM mutant complexed with atazanavir (BMS-232632)
1HVH 1998-12-30 1.8 NONPEPTIDE CYCLIC CYANOGUANIDINES AS HIV PROTEASE INHIBITORS
3KFS 2010-02-23 1.8 HIV Protease (PR) dimer with inhibitor TL-3 bound and fragment 2F4 in the outside/top of flap
2ZD1 2008-02-12 1.8 Crystal Structure of HIV-1 Reverse Transcriptase (RT) in Complex with TMC278 (Rilpivirine), A Non-nucleoside RT Inhibitor
3NXN 2011-11-02 1.8 X-ray structure of ester chemical analogue 'covalent dimer' [Ile50,O-Ile50']HIV-1 protease complexed with KVS-1 inhibitor
2XYF 2011-12-07 1.8 HIV-1 Inhibitors with a Tertiary-Alcohol-containing Transition-State Mimic and various P2 and P1 prime Substituents
3JW2 2009-12-08 1.8 HIV-1 Protease Mutant G86S with DARUNAVIR
3GI5 2010-03-09 1.8 Crystal structure of protease inhibitor, KB62 in complex with wild type HIV-1 protease
1FG6 2001-06-01 1.8 STRUCTURAL IMPLICATIONS OF DRUG RESISTANT MUTANTS OF HIV-1 PROTEASE: HIGH RESOLUTION CRYSTAL STRUCTURES OF THE MUTANT PROTEASE/SUBSTRATE ANALOG COMPLEXES
3ZPU 2013-11-06 1.8 Design and Synthesis of P1-P3 Macrocyclic Tertiary Alcohol Comprising HIV-1 Protease Inhibitors
4ICL 2013-02-06 1.8 HIV-1 reverse transcriptase with bound fragment at the incoming dNTP binding site
1HVK 1994-04-30 1.8 INFLUENCE OF STEREOCHEMISTRY ON ACTIVITY AND BINDING MODES FOR C2 SYMMETRY-BASED DIOL INHIBITORS OF HIV-1 PROTEASE
1QBU 1997-10-15 1.8 HIV-1 PROTEASE INHIBITORS WIIH LOW NANOMOLAR POTENCY
4K4R 2013-09-18 1.8 TL-3 inhibited Trp6Ala HIV Protease with 1-bromo-2-napthoic acid bound in exosite
1QBR 1997-10-15 1.8 HIV-1 PROTEASE INHIBITORS WIIH LOW NANOMOLAR POTENCY
3KDD 2010-03-02 1.8 Crystal Structure of HIV-1 Protease (Q7K, L33I, L63I) in Complex with KNI-10265
4J5J 2013-05-15 1.8 Crystal Structure of Multidrug Resistant HIV-1 Protease Clinical Isolate PR20 in Complex with Amprenavir
3JVW 2009-12-08 1.8 HIV-1 Protease Mutant G86A with symmetric inhibitor DMP323
4AHT 2012-12-19 1.8 Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
1W5W 2004-12-22 1.8 HIV-1 protease in complex with fluoro substituted diol-based C2- symmetric inhibitor
1FGL 1997-04-01 1.8 Cyclophilin A complexed with a fragment of HIV-1 GAG protein
4CPR 2014-12-17 1.8 Macrocyclic Transition-State Mimicking HIV-1 Protease Inhibitors Encompassing a Tertiary Alcohol
1EC3 2002-06-26 1.8 HIV-1 protease in complex with the inhibitor MSA367
3OUD 2011-03-30 1.8 MDR769 HIV-1 protease complexed with CA/p2 hepta-peptide
1HWR 1999-03-23 1.8 MOLECULAR RECOGNITION OF CYCLIC UREA HIV PROTEASE INHIBITORS
4AHV 2012-12-19 1.8 Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
4A6B 2012-05-09 1.8 Stereoselective Synthesis, X-ray Analysis, and Biological Evaluation of a New Class of Lactam Based HIV-1 Protease Inhibitors
4CP7 2014-12-10 1.8 Macrocyclic Transition-State Mimicking HIV-1 Protease Inhibitors Encompassing a Tertiary Alcohol
1EBW 2002-06-26 1.81 HIV-1 protease in complex with the inhibitor BEA322
1D4I 2002-06-26 1.81 HIV-1 protease in complex with the inhibitor BEA425
5HRP 2016-12-14 1.81 HIV Integrase Catalytic Domain containing F185K + A124T mutations complexed with GSK0002
1D4H 2002-06-26 1.81 HIV-1 Protease in complex with the inhibitor BEA435
4EP3 2012-06-06 1.81 Crystal Structure of inactive single chain wild-type HIV-1 Protease in Complex with the substrate CA-p2
2R38 2008-09-02 1.81 I84V HIV-1 protease mutant in complex with a carbamoyl decorated pyrrolidine-based inhibitor
1D4J 2002-06-26 1.81 HIV-1 protease in complex with the inhibitor MSL370
4CPU 2014-12-17 1.82 Macrocyclic Transition-State Mimicking HIV-1 Protease Inhibitors Encompassing a Tertiary Alcohol
3BC4 2008-09-02 1.82 I84V HIV-1 protease in complex with a pyrrolidine diester
4OJR 2014-06-11 1.82 Crystal Structure of the HIV-1 Integrase catalytic domain with GSK1264
1IIQ 2002-04-12 1.83 CRYSTAL STRUCTURE OF HIV-1 PROTEASE COMPLEXED WITH A HYDROXYETHYLAMINE PEPTIDOMIMETIC INHIBITOR
4QJ9 2014-10-29 1.83 Crystal structure of inactive HIV-1 protease in complex with p1-p6 substrate variant (R452S)
5TC2 2018-04-04 1.84 C-terminal domain of HIV-1 integrase, crystal structure
3GI6 2010-03-09 1.84 Crystal structure of protease inhibitor, AD78 in complex with wild type HIV-1 protease
1Z1H 2005-03-22 1.85 HIV-1 protease complexed with macrocyclic peptidomimetic inhibitor 3
1B6M 2000-01-07 1.85 HIV-1 PROTEASE COMPLEXED WITH MACROCYCLIC PEPTIDOMIMETIC INHIBITOR 6
4Q1W 2015-02-18 1.85 Mutations Outside the Active Site of HIV-1 Protease Alter Enzyme Structure and Dynamic Ensemble of the Active Site to Confer Drug Resistance
4CPX 2014-12-17 1.85 Macrocyclic Transition-State Mimicking HIV-1 Protease Inhibitors Encompassing a Tertiary Alcohol
4OBH 2014-11-26 1.85 Crystal Structure of Inactive HIV-1 Protease in Complex with the p1-p6 substrate variant (L449F)
2PYN 2008-02-26 1.85 HIV-1 PR mutant in complex with nelfinavir
1D4K 2000-10-11 1.85 HIV-1 PROTEASE COMPLEXED WITH A MACROCYCLIC PEPTIDOMIMETIC INHIBITOR
3NU9 2010-08-25 1.85 Crystal Structure of HIV-1 Protease Mutant I84V with Antiviral Drug Amprenavir
1B6K 2000-01-07 1.85 HIV-1 PROTEASE COMPLEXED WITH MACROCYCLIC PEPTIDOMIMETIC INHIBITOR 5
3DLK 2008-10-07 1.85 Crystal Structure of an engineered form of the HIV-1 Reverse Transcriptase, RT69A
1FF0 2001-06-01 1.85 STRUCTURAL IMPLICATIONS OF DRUG RESISTANT MUTANTS OF HIV-1 PROTEASE: HIGH RESOLUTION CRYSTAL STRUCTURES OF THE MUTANT PROTEASE/SUBSTRATE ANALOG COMPLEXES.
4F76 2013-05-15 1.85 Crystal Structure of the active HIV-1 Protease in Complex with the products of p1-p6 substrate
3MXE 2010-11-10 1.85 Crystal structure of HIV-1 protease inhibitor, KC32 complexed with wild-type protease
2QI5 2008-04-22 1.85 Crystal structure of protease inhibitor, MIT-2-KC08 in complex with wild type HIV-1 protease
2QI7 2008-04-22 1.85 Crystal structure of protease inhibitor, MIT-2-AD86 in complex with wild type HIV-1 protease
3GI4 2010-03-09 1.85 Crystal structure of protease inhibitor, KB60 in complex with wild type HIV-1 protease
6D0D 2019-05-01 1.85 X-ray crystal structure of wild type HIV-1 protease in complex with GRL-087-13
1FG8 2001-06-01 1.85 STRUCTURAL IMPLICATIONS OF DRUG RESISTANT MUTANTS OF HIV-1 PROTEASE: HIGH RESOLUTION CRYSTAL STRUCTURES OF THE MUTANT PROTEASE/SUBSTRATE ANALOG COMPLEXES
2FNS 2006-09-05 1.85 Crystal structure of wild-type inactive (D25N) HIV-1 protease complexed with wild-type HIV-1 NC-p1 substrate.
2QHZ 2008-04-22 1.85 Crystal structure of protease inhibitor, MIT-1-AC87 in complex with wild type HIV-1 protease
1B6J 2000-01-07 1.85 HIV-1 PROTEASE COMPLEXED WITH MACROCYCLIC PEPTIDOMIMETIC INHIBITOR 1
1Z1R 2005-03-22 1.85 HIV-1 protease complexed with Macrocyclic peptidomimetic inhibitor 2
2QHY 2008-04-22 1.85 Crystal Structure of protease inhibitor, MIT-1-AC86 in complex with wild type HIV-1 protease
4COP 2014-06-04 1.85 HIV-1 capsid C-terminal domain mutant (Y169S)
4KFB 2013-05-15 1.85 HIV-1 reverse transcriptase with bound fragment at NNRTI adjacent site
3AVB 2012-01-18 1.85 Crystal structures of novel allosteric peptide inhibitors of HIV integrase in the LEDGF binding site
2QI6 2008-04-22 1.85 Crystal structure of protease inhibitor, MIT-2-KB98 in complex with wild type HIV-1 protease
5HRS 2016-12-14 1.86 HIV Integrase Catalytic Domain containing F185K + A124N + T125A mutations complexed with GSK0002
4ID1 2013-05-01 1.87 HIV-1 Integrase Catalytic Core Domain Complexed with Allosteric Inhibitor
3AVH 2012-01-18 1.88 Crystal structures of novel allosteric peptide inhibitors of HIV integrase in the LEDGF binding site
1DW6 2000-07-26 1.88 Structural and kinetic analysis of drug resistant mutants of HIV-1 protease
5HRR 2016-12-14 1.88 HIV Integrase Catalytic Domain containing F185K + A124N + T125S mutations complexed with GSK0002
3AVM 2012-01-18 1.88 Crystal structures of novel allosteric peptide inhibitors of HIV integrase in the LEDGF binding site
3AVL 2012-01-18 1.88 Crystal structures of novel allosteric peptide inhibitors of HIV integrase in the LEDGF binding site
2XV6 2011-10-12 1.89 Crystal structure of the HIV-1 capsid protein C-terminal domain (146- 220) in complex with a camelid VHH.
1G6L 2000-11-15 1.9 1.9A CRYSTAL STRUCTURE OF TETHERED HIV-1 PROTEASE
2PYM 2008-02-26 1.9 HIV-1 PR mutant in complex with nelfinavir
3MGE 2010-07-21 1.9 X-ray Structure of Hexameric HIV-1 CA
3H47 2009-06-23 1.9 X-ray Structure of Hexameric HIV-1 CA
1FGC 2001-06-01 1.9 STRUCTURAL IMPLICATIONS OF DRUG RESISTANT MUTANTS OF HIV-1 PROTEASE: HIGH RESOLUTION CRYSTAL STRUCTURES OF THE MUTANT PROTEASE/SUBSTRATE ANALOG COMPLEXES
2WL0 2009-12-15 1.9 HIV-1 Protease Inhibitors Containing a Tertiary Alcohol in the Transition-State Mimic with Improved Cell-Based Antiviral Activity
4OBD 2014-11-26 1.9 Crystal Structure of Nelfinavir-Resistant, Inactive HIV-1 Protease (D30N/N88D) in Complex with the p1-p6 substrate variant (L449F/S451N)
3NWX 2011-11-02 1.9 X-ray structure of ester chemical analogue [O-Ile50,O-Ile50']HIV-1 protease complexed with KVS-1 inhibitor
1MET 1998-04-15 1.9 HIV-1 MUTANT (V82F) PROTEASE COMPLEXED WITH DMP323
5HGN 2016-08-10 1.9 Hexameric HIV-1 CA, apo form
1M9D 2003-05-27 1.9 X-ray crystal structure of Cyclophilin A/HIV-1 CA N-terminal domain (1-146) O-type chimera Complex.
1BWA 1998-10-30 1.9 HIV-1 PROTEASE (V82F/I84V) DOUBLE MUTANT COMPLEXED WITH XV638 OF DUPONT PHARMACEUTICALS
1MES 1998-04-15 1.9 HIV-1 MUTANT (I84V) PROTEASE COMPLEXED WITH DMP323
3NF6 2011-04-27 1.9 Structural basis for a new mechanism of inhibition of HIV integrase identified by fragment screening and structure based design
6BJ3 2018-07-25 1.9 TCR55 in complex with HIV(Pol448-456)/HLA-B35
4AHU 2012-12-19 1.9 Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
4EP2 2012-06-06 1.9 Crystal Structure of inactive single chain wild-type HIV-1 Protease in Complex with the substrate RT-RH
2GON 2006-09-26 1.9 Xray Structure of Gag133-278
2ZYE 2009-03-24 1.9 Structure of HIV-1 Protease in Complex with Potent Inhibitor KNI-272 Determined by Neutron Crystallography
6ES8 2018-08-15 1.9 HIV capsid hexamer with IP6 ligand
3BGB 2008-09-02 1.9 HIV-1 protease in complex with a isobutyl decorated oligoamine
1MER 1998-04-15 1.9 HIV-1 MUTANT (I84V) PROTEASE COMPLEXED WITH DMP450
1MT7 2003-01-07 1.9 Viability of a drug-resistant HIV-1 protease mutant: structural insights for better antiviral therapy
1W5Y 2004-10-07 1.9 HIV-1 protease in complex with fluoro substituted diol-based C2- symmetric inhibitor
4G9F 2013-03-20 1.9 Crystal Structure of C12C TCR-HLAB2705-KK10-L6M
1HPV 1995-03-31 1.9 CRYSTAL STRUCTURE OF HIV-1 PROTEASE IN COMPLEX WITH VX-478, A POTENT AND ORALLY BIOAVAILABLE INHIBITOR OF THE ENZYME
2PWM 2007-09-25 1.9 Crystal Structure of HIV-1 CA146 A92E real cell
3R4B 2011-09-21 1.9 Crystal Structure of Wild-type HIV-1 Protease in Complex With TMC310911
4Q1X 2015-02-18 1.9 Mutations Outside the Active Site of HIV-1 Protease Alter Enzyme Structure and Dynamic Ensemble of the Active Site to Confer Drug Resistance
1SGU 2004-10-05 1.9 Comparing the Accumulation of Active Site and Non-active Site Mutations in the HIV-1 Protease
2BPY 1999-02-23 1.9 HIV-1 protease-inhibitor complex
4DQF 2012-03-07 1.9 Crystal Structure of (G16A/L38A) HIV-1 Protease in Complex with DRV
4DGA 2012-02-08 1.9 TRIMCyp cyclophilin domain from Macaca mulatta: HIV-1 CA(O-loop) complex
1MEU 1998-04-15 1.9 HIV-1 MUTANT (V82F, I84V) PROTEASE COMPLEXED WITH DMP323
3NF8 2011-04-27 1.9 Structural basis for a new mechanism of inhibition of HIV integrase identified by fragment screening and structure based design
6C0O 2018-08-01 1.9 Crystal structure of HIV-1 K103N mutant reverse transcriptase in complex with non-nucleoside inhibitor 25a
4AHR 2012-12-19 1.9 Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
2BPV 1999-02-23 1.9 HIV-1 protease-inhibitor complex
4E1M 2012-04-25 1.9 Crystal Structure of HIV-1 Integrase with a non-catayltic site inhibitor
1FFF 2001-06-01 1.9 STRUCTURAL IMPLICATIONS OF DRUG RESISTANT MUTANTS OF HIV-1 PROTEASE : HIGH RESOLUTION CRYSTAL STRUCTURES OF THE MUTANT PROTEASE/SUBSTRATE ANALOG COMPLEXES.
1W5X 2004-12-22 1.9 HIV-1 protease in complex with fluoro substituted diol-based C2- symmetric inhibitor
4NYF 2014-06-25 1.9 HIV integrase in complex with inhibitor
4QGI 2014-07-16 1.9 X-ray crystal structure of HIV-1 protease variant G48T/L89M in complex with Saquinavir
5TSX 2017-11-08 1.9 HIV-1 CA hexamer with NUP153 peptide - P1 crystal form
2AID 1997-10-15 1.9 STRUCTURE OF A NON-PEPTIDE INHIBITOR COMPLEXED WITH HIV-1 PROTEASE: DEVELOPING A CYCLE OF STRUCTURE-BASED DRUG DESIGN
4F73 2013-05-15 1.9 Crystal Structure of active HIV-1 Protease in Complex with the N terminal product of CA-p2 cleavage site
6C0J 2018-08-01 1.92 Crystal structure of HIV-1 reverse transcriptase in complex with non-nucleoside inhibitor K-5a2
2R3W 2008-09-02 1.92 I84V HIV-1 protease in complex with a amino decorated pyrrolidine-based inhibitor
4U1I 2015-04-08 1.92 HLA class I micropolymorphisms determine peptide-HLA landscape and dictate differential HIV-1 escape through identical epitopes
1ZJ7 2006-05-09 1.93 Crystal structure of a complex of mutant HIV-1 protease (A71V, V82T, I84V) with a hydroxyethylamine peptidomimetic inhibitor BOC-PHE-PSI[S-CH(OH)CH2NH]-PHE-GLU-PHE-NH2
4DQC 2012-03-07 1.94 Crystal Structure of (G16C/L38C) HIV-1 Protease in Complex with DRV
6CGF 2018-08-01 1.94 Crystal structure of HIV-1 Y188L mutant reverse transcriptase in complex with non-nucleoside inhibitor K-5a2
6C8Y 2018-12-05 1.94 D30N HIV-1 protease in complex with a phenylboronic acid (P2') analog of darunavir
1BIS 1998-08-19 1.95 HIV-1 INTEGRASE CORE DOMAIN
6D0E 2019-05-01 1.95 X-ray crystal structure of wild type HIV-1 protease in complex with GRL-084-13
3NF9 2011-04-27 1.95 Structural basis for a new mechanism of inhibition of HIV integrase identified by fragment screening and structure based design
3OXW 2011-09-28 1.95 Crystal Structure of HIV-1 I50V, A71V Protease in Complex with the Protease Inhibitor Darunavir
4HLA 2013-07-24 1.95 Crystal structure of wild type HIV-1 protease in complex with darunavir
2X2D 2010-03-23 1.95 acetyl-CypA:HIV-1 N-term capsid domain complex
4IG3 2013-02-06 1.95 HIV-1 reverse transcriptase with bound fragment near Knuckles site
3NFA 2011-04-27 1.95 Structural basis for a new mechanism of inhibition of HIV integrase identified by fragment screening and structure based design
4KO0 2013-08-14 1.95 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE (RT) IN COMPLEX WITH an anilinylpyrimidine derivative (JLJ-135)
6C0L 2018-08-01 1.95 Crystal structure of HIV-1 E138K mutant reverse transcriptase in complex with non-nucleoside inhibitor K-5a2
1BIZ 1998-08-19 1.95 HIV-1 INTEGRASE CORE DOMAIN
1G2K 2001-06-01 1.95 HIV-1 PROTEASE WITH CYCLIC SULFAMIDE INHIBITOR, AHA047
4ID5 2013-02-06 1.95 HIV-1 reverse transcriptase with bound fragment at the RNase H primer grip site
4XRQ 2015-07-15 1.95 Disulfide stabilized HIV-1 CA hexamer 4mut (S41A, Q67H, V165I, L172I) in complex with PF-3450074
5HGP 2016-10-19 1.95 Hexameric HIV-1 CA in complex with hexacarboxybenzene
2QI3 2008-04-22 1.95 Crystal structure of protease inhibitor, MIT-2-AD94 in complex with wild type HIV-1 protease
4LQW 2013-08-14 1.95 Crystal structure of HIV-1 capsid N-terminal domain in complex with NUP358 cyclophilin
3MXD 2010-11-10 1.95 Crystal structure of HIV-1 protease inhibitor KC53 in complex with wild-type protease
3LZS 2010-08-11 1.95 Crystal Structure of HIV-1 CRF01_AE Protease in Complex with Darunavir
4I8W 2013-07-24 1.96 Crystal structure of wild type HIV-1 protease in complex with non-peptidic inhibitor, GRL007
6DUF 2018-08-01 1.96 Crystal structure of HIV-1 reverse transcriptase V106A/F227L mutant in complex with non-nucleoside inhibitor 25a
6C0K 2018-08-01 1.96 Crystal structure of HIV-1 K103N mutant reverse transcriptase in complex with non-nucleoside inhibitor K-5a2
3EKX 2009-09-01 1.97 Crystal structure of the wild-type HIV-1 protease with the inhibitor, Nelfinavir
3EKT 2009-09-01 1.97 Crystal Structure of the inhibitor Darunavir (DRV) in complex with a multi-drug resistant HIV-1 protease variant (L10F/G48V/I54V/V64I/V82A) (Refer: FLAP+ in citation.)
1D4Y 1999-10-13 1.97 HIV-1 PROTEASE TRIPLE MUTANT/TIPRANAVIR COMPLEX
3LRY 2010-03-09 1.98 Crystal structure of synthetic HIV-1 capsid C-terminal domain (CCA)
6BHS 2018-08-01 1.98 HIV-1 CA hexamer in complex with IP6, hexagonal crystal form
1ZSF 2006-04-25 1.98 Crystal Structure of Complex of a Hydroxyethylamine Inhibitor with HIV-1 Protease at 2.0A Resolution
4E1N 2012-04-25 2.0 Crystal Structure of HIV-1 Integrase with a non-catayltic site inhibitor
1KJG 2002-03-06 2.0 SUBSTRATE SHAPE DETERMINES SPECIFICITY OF RECOGNITION RECOGNITION FOR HIV-1 PROTEASE: ANALYSIS OF CRYSTAL STRUCTURES OF SIX SUBSTRATE COMPLEXES
1A8K 1999-01-13 2.0 CRYSTALLOGRAPHIC ANALYSIS OF HUMAN IMMUNODEFICIENCY VIRUS 1 PROTEASE WITH AN ANALOG OF THE CONSERVED CA-P2 SUBSTRATE: INTERACTIONS WITH FREQUENTLY OCCURRING GLUTAMIC ACID RESIDUE AT P2' POSITION OF SUBSTRATES
2QI1 2008-04-22 2.0 Crystal structure of protease inhibitor, MIT-1-KK81 in complex with wild type HIV-1 protease
2AQU 2006-08-29 2.0 Structure of HIV-1 protease bound to atazanavir
1BV9 1998-09-30 2.0 HIV-1 PROTEASE (I84V) COMPLEXED WITH XV638 OF DUPONT PHARMACEUTICALS
4QNB 2014-12-31 2.0 Disulfide stabilized HIV-1 CA hexamer in complex with PHENYL-L-PHENYLALANINAMIDE inhibitor
5V5L 2017-06-14 2.0 Crystal structure of HLA-B*5801 complex with HIV-1 gag derived peptide TW10
2NXL 2007-09-18 2.0 Structure of HIV-1 protease D25N complexed with the rt-rh analogue peptide GLY-ALA-GLU-VAL-PHE*TYR-VAL-ASP-GLY-ALA
1AXA 1998-04-15 2.0 ACTIVE-SITE MOBILITY IN HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 PROTEASE AS DEMONSTRATED BY CRYSTAL STRUCTURE OF A28S MUTANT
1AJX 1997-09-17 2.0 HIV-1 PROTEASE IN COMPLEX WITH THE CYCLIC UREA INHIBITOR AHA001
1NPA 2004-01-27 2.0 crystal structure of HIV-1 protease-hup
1B6P 2000-01-07 2.0 HIV-1 PROTEASE COMPLEXED WITH MACROCYCLIC PEPTIDOMIMETIC INHIBITOR 7
1HPX 1996-03-08 2.0 HIV-1 PROTEASE COMPLEXED WITH THE INHIBITOR KNI-272
7UPJ 1997-04-21 2.0 HIV-1 PROTEASE/U101935 COMPLEX
1MT9 2003-01-07 2.0 Viability of a drug-resistant HIV-1 protease mutant: structural insights for better antiviral therapy
3TLH 1998-12-09 2.0 STRUCTURAL STUDIES OF HIV AND FIV PROTEASES COMPLEXED WITHAN EFFICIENT INHIBITOR OF FIV PR
1HVJ 1994-04-30 2.0 INFLUENCE OF STEREOCHEMISTRY ON ACTIVITY AND BINDING MODES FOR C2 SYMMETRY-BASED DIOL INHIBITORS OF HIV-1 PROTEASE
1ZBG 2006-04-18 2.0 Crystal structure of a complex of mutant hiv-1 protease (A71V, V82T, I84V) with a hydroxyethylamine peptidomimetic inhibitor BOC-PHE-PSI[R-CH(OH)CH2NH]-PHE-GLU-PHE-NH2
1KJH 2002-03-06 2.0 SUBSTRATE SHAPE DETERMINES SPECIFICITY OF RECOGNITION RECOGNITION FOR HIV-1 PROTEASE: ANALYSIS OF CRYSTAL STRUCTURES OF SIX SUBSTRATE COMPLEXES
4QJ8 2014-10-29 2.0 Crystal structure of inactive HIV-1 protease variant (I50V/A71V) in complex with p1-p6 substrate variant (P453L)
1KJ7 2002-03-06 2.0 SUBSTRATE SHAPE DETERMINES SPECIFICITY OF RECOGNITION RECOGNITION FOR HIV-1 PROTEASE: ANALYSIS OF CRYSTAL STRUCTURES OF SIX SUBSTRATE COMPLEXES
2XYE 2011-12-07 2.0 HIV-1 Inhibitors with a Tertiary-Alcohol-containing Transition-State Mimic and various P2 and P1 prime Substituents
2AZ8 2006-02-28 2.0 HIV-1 Protease NL4-3 in complex with inhibitor, TL-3
6CPN 2018-06-06 2.0 Crystal structure of DR11 presenting the RQ13 peptide
1MRW 2003-11-04 2.0 Structure of HIV protease (Mutant Q7K L33I L63I) complexed with KNI-577
1DMP 1997-11-12 2.0 STRUCTURE OF HIV-1 PROTEASE COMPLEX
5VJ3 2018-04-18 2.0 HIV Protease (PR) in open form with Mg2+ in active site and HIVE-9 in eye site
4JMU 2013-10-30 2.0 Crystal structure of HIV matrix residues 1-111 in complex with inhibitor
1F7A 2001-06-27 2.0 HOW DOES A SYMMETRIC DIMER RECOGNIZE AN ASYMMETRIC SUBSTRATE? A SUBSTRATE COMPLEX OF HIV-1 PROTEASE.
1HSG 1996-04-03 2.0 CRYSTAL STRUCTURE AT 1.9 ANGSTROMS RESOLUTION OF HUMAN IMMUNODEFICIENCY VIRUS (HIV) II PROTEASE COMPLEXED WITH L-735,524, AN ORALLY BIOAVAILABLE INHIBITOR OF THE HIV PROTEASES
1NPW 2003-02-04 2.0 Crystal structure of HIV protease complexed with LGZ479
1AJV 1997-08-20 2.0 HIV-1 PROTEASE IN COMPLEX WITH THE CYCLIC SULFAMIDE INHIBITOR AHA006
1RL8 2005-04-19 2.0 Crystal structure of the complex of resistant strain of hiv-1 protease(v82a mutant) with ritonavir
5T6Z 2017-03-01 2.0 KIR3DL1 in complex with HLA-B*57:01-TW10
1BV7 1998-09-30 2.0 COUNTERACTING HIV-1 PROTEASE DRUG RESISTANCE: STRUCTURAL ANALYSIS OF MUTANT PROTEASES COMPLEXED WITH XV638 AND SD146, CYCLIC UREA AMIDES WITH BROAD SPECIFICITIES
1HIV 1993-10-31 2.0 CRYSTAL STRUCTURE OF A COMPLEX OF HIV-1 PROTEASE WITH A DIHYDROETHYLENE-CONTAINING INHIBITOR: COMPARISONS WITH MOLECULAR MODELING
6DUH 2018-08-01 2.0 Crystal structure of HIV-1 reverse transcriptase Y181I mutant in complex with non-nucleoside inhibitor 25a
1K6V 2002-02-06 2.0 LACK OF SYNERGY FOR INHIBITORS TARGETING A MULTI-DRUG RESISTANT HIV-1 PROTEASE
1TSQ 2005-03-29 2.0 CRYSTAL STRUCTURE OF AP2V SUBSTRATE VARIANT OF NC-P1 DECAMER PEPTIDE IN COMPLEX WITH V82A/D25N HIV-1 PROTEASE MUTANT
2NXD 2007-09-18 2.0 Structure of HIV-1 protease D25N complexed with rt-rh analogue peptide GLY-ALA-ASP-ILE-PHE*TYR-LEU-ASP-GLY-ALA
1NPV 2003-02-04 2.0 Crystal structure of HIV-1 protease complexed with LDC271
2FGU 2006-11-07 2.0 X-ray crystal structure of HIV-1 Protease T80S variant in complex with the inhibitor saquinavir used to explore the role of invariant Thr80 in HIV-1 protease structure, function, and viral infectivity.
2O4N 2006-12-12 2.0 Crystal Structure of HIV-1 Protease (TRM Mutant) in Complex with Tipranavir
1BL3 1998-09-30 2.0 CATALYTIC DOMAIN OF HIV-1 INTEGRASE
1ODX 1997-04-01 2.0 HIV-1 Proteinase mutant A71T, V82A
5VEA 2018-04-25 2.0 HIV Protease (PR) with TL-3 in active site and 4-methylbenzene-1,2-diamine in exosite
1A94 1999-01-13 2.0 STRUCTURAL BASIS FOR SPECIFICITY OF RETROVIRAL PROTEASES
1EC2 2002-06-26 2.0 HIV-1 protease in complex with the inhibitor BEA428
1MSM 2003-11-04 2.0 The HIV protease (mutant Q7K L33I L63I) complexed with KNI-764 (an inhibitor)
1KJF 2002-03-06 2.0 SUBSTRATE SHAPE DETERMINES SPECIFICITY OF RECOGNITION RECOGNITION FOR HIV-1 PROTEASE: ANALYSIS OF CRYSTAL STRUCTURES OF SIX SUBSTRATE COMPLEXES
4FE6 2012-07-18 2.0 Crystal Structure of HIV-1 Protease in Complex with an enamino-oxindole inhibitor
6C0N 2018-08-01 2.0 Crystal structure of HIV-1 reverse transcriptase in complex with non-nucleoside inhibitor 25a
3EL4 2009-09-01 2.0 Crystal structure of inhibitor saquinavir (SQV) complexed with the multidrug HIV-1 protease variant L63P/V82T/I84V
3EL0 2009-09-01 2.0 Crystal structure of the inhibitor Nelfinavir (NFV) in complex with a multi-drug resistant HIV-1 protease variant (L10I/G48V/I54V/V64I/V82A) (Refer: FLAP+ in citation)
2Q3K 2007-08-21 2.0 Crystal Structure of Lysine Sulfonamide Inhibitor Reveals the Displacement of the Conserved Flap Water Molecule in HIV-1 Protease
1ODY 1999-02-16 2.0 HIV-1 PROTEASE COMPLEXED WITH AN INHIBITOR LP-130
6H09 2018-08-15 2.0 HIV capsid hexamer with IP6 ligand
3OUC 2011-03-30 2.0 MDR769 HIV-1 protease complexed with p2/NC hepta-peptide
1MSN 2003-11-04 2.0 The HIV protease (mutant Q7K L33I L63I V82F I84V) complexed with KNI-764 (an inhibitor)
5HVP 1991-10-15 2.0 CRYSTALLOGRAPHIC ANALYSIS OF A COMPLEX BETWEEN HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 PROTEASE AND ACETYL-PEPSTATIN AT 2.0-ANGSTROMS RESOLUTION
1A30 1998-04-29 2.0 HIV-1 PROTEASE COMPLEXED WITH A TRIPEPTIDE INHIBITOR
1MRX 2003-11-04 2.0 Structure of HIV protease (Mutant Q7K L33I L63I V82F I84V ) complexed with KNI-577
1HTG 1994-07-31 2.0 X-RAY CRYSTALLOGRAPHIC STUDIES OF A SERIES OF PENICILLIN-DERIVED ASYMMETRIC INHIBITORS OF HIV-1 PROTEASE
5HGO 2016-08-10 2.0 Hexameric HIV-1 CA R18G mutant
6B2K 2018-09-26 2.0 E45A/R132T mutant of HIV-1 capsid protein
3DOX 2008-09-09 2.0 X-ray structure of HIV-1 protease in situ product complex
2AZC 2006-02-28 2.01 HIV-1 Protease NL4-3 6X mutant
4XRO 2015-07-15 2.01 Disulfide stabilized HIV-1 CA hexamer 4mut (S41A, Q67H, V165I, L172I)
3DPH 2008-09-02 2.01 HIV-1 capsid C-terminal domain mutant (L211S)
6EX9 2018-06-06 2.01 Crystal Structure of HIV-1 Integrase Catalytic Core Domain with Inhibitor Peptide
1EBZ 2002-06-26 2.01 HIV-1 protease in complex with the inhibitor BEA388
1B92 1999-07-19 2.02 MOBILITY OF AN HIV-1 INTEGRASE ACTIVE SITE LOOP IS CORRELATED WITH CATALYTIC ACTIVITY
1ZPA 2005-05-31 2.02 HIV Protease with Scripps AB-3 Inhibitor
2B4J 2005-10-25 2.02 Structural basis for the recognition between HIV-1 integrase and LEDGF/p75
2AZB 2006-02-28 2.03 HIV-1 Protease NL4-3 3X mutant in complex with inhibitor, TL-3
4U0E 2014-11-12 2.04 Hexameric HIV-1 CA in complex with PF3450074
3K2P 2010-02-09 2.04 HIV-1 Reverse Transcriptase Isolated RnaseH Domain with the Inhibitor beta-thujaplicinol Bound at the Active Site
5HGM 2016-08-10 2.04 Hexameric HIV-1 CA in complex with dATP
3U7S 2012-01-18 2.05 HIV PR drug resistant patient's variant in complex with darunavir
1CPI 1996-03-08 2.05 REGIOSELECTIVE STRUCTURAL AND FUNCTIONAL MIMICRY OF PEPTIDES. DESIGN OF HYDROLYTICALLY STABLE CYCLIC PEPTIDOMIMETIC INHIBITORS OF HIV-1 PROTEASE
4U0A 2014-11-12 2.05 Hexameric HIV-1 CA in complex with CPSF6 peptide, P6 crystal form
4IFV 2013-02-06 2.05 Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-Ray Crystallographic Fragment Screening
6C0P 2018-08-01 2.05 Crystal structure of HIV-1 E138K mutant reverse transcriptase in complex with non-nucleoside inhibitor 25a
4O0J 2014-07-02 2.05 HIV-1 Integrase Catalytic Core Domain Complexed with Allosteric Inhibitor (2S)-tert-butoxy[4-(4-chlorophenyl)-6-(3,4-dimethylphenyl)-2,5-dimethylpyridin-3-yl]ethanoic acid
6C0R 2018-08-01 2.05 Crystal structure of HIV-1 K103N/Y181C mutant reverse transcriptase in complex with non-nucleoside inhibitor 25a
5TEO 2017-09-27 2.05 Dimer of HIV-1 Gag CTD-SP1 fragment
1ZSR 2006-04-25 2.06 Crystal structure of wild type HIV-1 protease (BRU isolate) with a hydroxyethylamine peptidomimetic inhibitor BOC-PHE-PSI[S-CH(OH)CH2NH]-PHE-GLU-PHE-NH2
1EBK 2000-07-26 2.06 Structural and kinetic analysis of drug resistant mutants of HIV-1 protease
3PSU 2011-12-07 2.07 HIV-1 protease in complex with an isobutyl decorated oligoamine (symmetric binding mode)
5W4O 2018-06-20 2.09 Structure of the R18A mutant of the HIV-1 capsid protein
3QIP 2011-04-20 2.09 Structure of HIV-1 reverse transcriptase in complex with an RNase H inhibitor and nevirapine
4JLH 2013-05-01 2.09 HIV-1 Integrase Catalytic Core Domain A128T Mutant Complexed with Allosteric Inhibitor
1T7K 2004-10-05 2.1 Crystal Structure of HIV Protease complexed with Arylsulfonamide azacyclic urea
3EM6 2009-09-01 2.1 Crystal structure of I50L/A71V mutant of hiv-1 protease in complex with inhibitor darunavir
1QBT 1997-10-15 2.1 HIV-1 PROTEASE INHIBITORS WIIH LOW NANOMOLAR POTENCY
1QS4 1999-11-17 2.1 Core domain of HIV-1 integrase complexed with Mg++ and 1-(5-chloroindol-3-yl)-3-hydroxy-3-(2H-tetrazol-5-yl)-propenone
2QI0 2008-04-22 2.1 Crystal structure of protease inhibitor, MIT-1-KK80 in complex with wild type HIV-1 protease
1LV1 2002-06-19 2.1 Crystal Structure Analysis of the non-active site mutant of tethered HIV-1 protease to 2.1A resolution
4IDK 2013-02-06 2.1 HIV-1 reverse transcriptase with bound fragment at the 428 site
4PHV 1993-10-31 2.1 X-RAY CRYSTAL STRUCTURE OF THE HIV PROTEASE COMPLEX WITH L-700,417, AN INHIBITOR WITH PSEUDO C2 SYMMETRY
5T70 2017-03-01 2.1 KIR3DL1 in complex with HLA-B*57:01 presenting TSNLQEQIGW
1EC1 2002-06-26 2.1 HIV-1 protease in complex with the inhibitor BEA409
3AVN 2012-01-18 2.1 Crystal structures of novel allosteric peptide inhibitors of HIV integrase in the LEDGF binding site
1TSU 2005-03-29 2.1 CRYSTAL STRUCTURE OF DECAMER NCP1 SUBSTRATE PEPTIDE IN COMPLEX WITH WILD-TYPE D25N HIV-1 PROTEASE VARIANT
4IFY 2013-02-06 2.1 HIV-1 reverse transcriptase with bound fragment at the Knuckles site
3BGR 2008-02-12 2.1 Crystal structure of K103N/Y181C mutant HIV-1 reverse transcriptase (RT) in complex with TMC278 (Rilpivirine), a non-nucleoside RT inhibitor
3EM4 2009-09-01 2.1 Crystal structure of atazanavir (ATV) in complex with I50L/A71V drug-resistant HIV-1 protease
5CYM 2015-12-30 2.1 HIV-1 reverse transcriptase complexed with 4-iodopyrazole
3T3C 2012-06-20 2.1 Structure of HIV PR resistant patient derived mutant (comprising 22 mutations) in complex with DRV
2X4U 2010-03-02 2.1 Crystal structure of MHC CLass I HLA-A2.1 bound to HIV-1 Peptide RT468-476
4FAF 2012-08-29 2.1 Substrate CA/p2 in Complex with a Human Immunodeficiency Virus Type 1 Protease Variant
1ODW 1997-04-01 2.1 Native HIV-1 Proteinase
2YNG 2013-01-09 2.12 HIV-1 Reverse Transcriptase in complex with inhibitor GSK560
2YKN 2011-08-17 2.12 Crystal structure of HIV-1 Reverse Transcriptase (RT) in complex with a Difluoromethylbenzoxazole (DFMB) Pyrimidine Thioether derivative, a non-nucleoside RT inhibitor (NNRTI)
5IND 2016-10-05 2.13 Crystal structure of HLA-B5801, a protective HLA allele for HIV-1 infection
4QJ2 2014-10-29 2.13 Crystal structure of inactive HIV-1 protease variant (I50V/A71V) in complex with WT p1-p6 substrate
1MT8 2003-01-07 2.15 Viability of a drug-resistant HIV-1 protease mutant: structural insights for better antiviral therapy
1ZTZ 2005-11-01 2.15 Crystal structure of HIV protease- metallacarborane complex
5CYQ 2015-12-30 2.15 HIV-1 reverse transcriptase complexed with 4-bromopyrazole
4DG1 2012-06-20 2.15 Crystal structure of HIV-1 reverse transcriptase (RT) with polymorphism mutation K172A and K173A
3LZV 2010-08-11 2.15 Structure of Nelfinavir-resistant HIV-1 protease (D30N/N88D) in complex with Darunavir.
1IZI 2002-12-23 2.15 Inhibitor of HIV protease with unusual binding mode potently inhibiting multi-resistant protease mutants
3EKP 2009-09-01 2.15 Crystal Structure of the inhibitor Amprenavir (APV) in complex with a multi-drug resistant HIV-1 protease variant (L10I/G48V/I54V/V64I/V82A)Refer: FLAP+ in citation
4GVM 2013-05-01 2.16 HIV-1 Integrase Catalytic Core Domain A128T Mutant Complexed with Allosteric Inhibitor
5W4P 2018-06-20 2.19 Structure of the E28A mutant of the HIV-1 capsid protein
3EM3 2009-09-01 2.2 Crystal structure of amprenavir (APV) in complex with a drug resistant HIV-1 protease variant (I50L/A71V).
6ELI 2018-04-11 2.2 Structure of HIV-1 reverse transcriptase (RT) in complex with rilpivirine and an RNase H inhibitor XZ462
3KDC 2010-03-16 2.2 Crystal Structure of HIV-1 Protease (Q7K, L33I, L63I) in Complex with KNI-10074
1HEG 1994-05-31 2.2 The crystal structures at 2.2 angstroms resolution of hydroxyethylene-based inhibitors bound to human immunodeficiency virus type 1 protease show that the inhibitors are present in two distinct orientations
5OI2 2018-03-07 2.2 Dissociation of biochemical and antiretroviral activities of Integrase-LEDGF Allosteric Inhibitors revealed by resistance of A125 polymorphic HIV-1
2QAK 2008-07-01 2.2 HIV-1 PR mutant in complex with nelfinavir
5OIA 2018-03-07 2.2 Dissociation of biochemical and antiretroviral activities of Integrase-LEDGF Allosteric Inhibitors revealed by resistance of A125 polymorphic HIV-1
1N49 2003-01-07 2.2 Viability of a Drug-Resistant HIV-1 Protease Variant: Structural Insights for Better Anti-Viral Therapy
1RTH 1996-04-03 2.2 HIGH RESOLUTION STRUCTURES OF HIV-1 RT FROM FOUR RT-INHIBITOR COMPLEXES
2Q63 2008-02-26 2.2 HIV-1 PR mutant in complex with nelfinavir
1BHL 1998-10-14 2.2 CACODYLATED CATALYTIC DOMAIN OF HIV-1 INTEGRASE
3UHL 2012-03-28 2.2 Crystal Structure of Multidrug Resistant HIV-1 Protease Clinical Isolate PR20 in Complex with p2-NC substrate analog
1E27 2000-09-12 2.2 Nonstandard peptide binding of HLA-B*5101 complexed with HIV immunodominant epitope KM1(LPPVVAKEI)
1K2C 2002-07-10 2.2 Combining Mutations in HIV-1 Protease to Understand Mechanisms of Resistance
4DGE 2012-02-08 2.2 TRIMCyp cyclophilin domain from Macaca mulatta: H70C mutant, HIV-1 CA(O-loop) complex
1YTH 1997-03-12 2.2 SIV PROTEASE CRYSTALLIZED WITH PEPTIDE PRODUCT
1HTF 1994-07-31 2.2 X-RAY CRYSTALLOGRAPHIC STUDIES OF A SERIES OF PENICILLIN-DERIVED ASYMMETRIC INHIBITORS OF HIV-1 PROTEASE
1VRT 1996-04-03 2.2 HIGH RESOLUTION STRUCTURES OF HIV-1 RT FROM FOUR RT-INHIBITOR COMPLEXES
1HAR 1995-04-20 2.2 2.2 ANGSTROMS RESOLUTION STRUCTURE OF THE AMINO-TERMINAL HALF OF HIV-1 REVERSE TRANSCRIPTASE (FINGERS AND PALM SUBDOMAINS)
3EKQ 2009-09-01 2.2 Crystal structure of inhibitor saquinavir (SQV) in complex with multi-drug resistant HIV-1 protease (L63P/V82T/I84V) (referred to as ACT in paper)
1U8G 2004-11-02 2.2 Crystal structure of a HIV-1 Protease in complex with peptidomimetic inhibitor KI2-PHE-GLU-GLU-NH2
1K6P 2002-02-06 2.2 LACK OF SYNERGY FOR INHIBITORS TARGETING A MULTI-DRUG RESISTANT HIV-1 PROTEASE
1LZQ 2003-04-29 2.2 Crystal structure of the complex of mutant HIV-1 protease (A71V, V82T, I84V) with an ethylenamine peptidomimetic inhibitor BOC-PHE-PSI[CH2CH2NH]-PHE-GLU-PHE-NH2
1K6C 2002-02-06 2.2 LACK OF SYNERGY FOR INHIBITORS TARGETING A MULTI-DRUG RESISTANT HIV-1 PROTEASE
2B7Z 2006-11-14 2.2 Structure of HIV-1 protease mutant bound to indinavir
4F74 2013-05-15 2.2 Crystal Structure of active HIV-1 Protease in Complex with the N terminal product of the substrate MA-CA.
1T7J 2005-05-10 2.2 crystal structure of inhibitor amprenavir in complex with a multi-drug resistant variant of HIV-1 protease (L63P/V82T/I84V)
1HIH 1995-07-10 2.2 COMPARATIVE ANALYSIS OF THE X-RAY STRUCTURES OF HIV-1 AND HIV-2 PROTEASES IN COMPLEX WITH CGP 53820, A NOVEL PSEUDOSYMMETRIC INHIBITOR
1HEF 1994-05-31 2.2 The crystal structures at 2.2 angstroms resolution of hydroxyethylene-based inhibitors bound to human immunodeficiency virus type 1 protease show that the inhibitors are present in two distinct orientations
1AID 1997-10-15 2.2 STRUCTURE OF A NON-PEPTIDE INHIBITOR COMPLEXED WITH HIV-1 PROTEASE: DEVELOPING A CYCLE OF STRUCTURE-BASED DRUG DESIGN
3DLG 2008-08-12 2.2 Crystal structure of hiv-1 reverse transcriptase in complex with GW564511.
1Z8C 2006-03-21 2.2 Crystal structure of the complex of mutant HIV-1 protease (l63P, A71V, V82T, I84V) with a hydroxyethylamine peptidomimetic inhibitor BOC-PHE-PSI[R-CH(OH)CH2NH]-PHE-GLU-PHE-NH2
6B2J 2018-09-26 2.21 E45A mutant of HIV-1 capsid protein (other crystal form)
6DUG 2018-08-01 2.22 Crystal structure of HIV-1 reverse transcriptase K101P mutant in complex with non-nucleoside inhibitor 25a
1UPJ 1996-10-14 2.22 HIV-1 PROTEASE COMPLEX WITH U095438 [3-[1-(4-BROMOPHENYL) ISOBUTYL]-4-HYDROXYCOUMARIN
3T11 2012-08-22 2.22 Dimeric inhibitor of HIV-1 protease.
4U0F 2014-11-12 2.22 Hexameric HIV-1 CA in Complex with BI-2
3TTP 2012-09-26 2.23 Structure of multiresistant HIV-1 protease in complex with darunavir
3LP1 2010-06-09 2.23 HIV-1 reverse transcriptase with inhibitor
5VQZ 2017-08-23 2.23 Crystal Structure of HIV-1 Reverse Transcriptase (K103N, Y181C) Variant in Complex with 2-chloro-N-(6-cyano-3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)-4-methylnaphthalen-1-yl)-N-methylacetamide (JLJ686), a Non-nucleoside Inhibitor
4O55 2014-07-02 2.24 HIV-1 Integrase Catalytic Core Domain Complexed with Allosteric Inhibitor (2S)-tert-butoxy[6-(5-chloro-1H-benzimidazol-2-yl)-2,5-dimethyl-4-phenylpyridin-3-yl]ethanoic acid
2NXM 2007-09-18 2.25 Structure of HIV-1 protease D25N complexed with the rt-rh analogue peptide GLY-ALA-GLN-THR-PHE*TYR-VAL-ASP-GLY-ALA
1K6T 2002-02-06 2.25 LACK OF SYNERGY FOR INHIBITORS TARGETING A MULTI-DRUG RESISTANT HIV-1 PROTEASE
1HVS 1995-02-14 2.25 STRUCTURAL BASIS OF DRUG RESISTANCE FOR THE V82A MUTANT OF HIV-1 PROTEASE: BACKBONE FLEXIBILITY AND SUBSITE REPACKING
3OQA 2011-04-06 2.25 Crystal Structures of Multidrug-Resistant Clinical Isolate 769 HIV-1 Protease Variants
3PJ6 2011-04-06 2.25 Crystal Structures of Multidrug-Resistant Clinical Isolate 769 HIV-1 Protease Variants
1SJH 2004-08-17 2.25 HLA-DR1 complexed with a 13 residue HIV capsid peptide
1EBY 2002-06-26 2.29 HIV-1 protease in complex with the inhibitor BEA369
5W4Q 2018-06-20 2.29 Structure of the R18A/E28A mutant of the HIV-1 capsid protein
1GNN 1996-11-08 2.3 HIV-1 PROTEASE MUTANT WITH VAL 82 REPLACED BY ASN (V82N) COMPLEXED WITH U89360E (INHIBITOR)
2R5P 2007-11-20 2.3 Crystal Structure Analysis of HIV-1 Subtype C Protease Complexed with Indinavir
1A9M 1998-06-17 2.3 G48H MUTANT OF HIV-1 PROTEASE IN COMPLEX WITH A PEPTIDIC INHIBITOR U-89360E
2R5Q 2007-11-20 2.3 Crystal Structure Analysis of HIV-1 Subtype C Protease Complexed with Nelfinavir
1ITG 1995-05-08 2.3 CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF HIV-1 INTEGRASE: SIMILARITY TO OTHER POLYNUCLEOTIDYL TRANSFERASES
3MEC 2010-05-12 2.3 HIV-1 Reverse Transcriptase in Complex with TMC125
1SBG 1994-10-15 2.3 AN ORALLY-BIOAVAILABLE HIV-1 PROTEASE INHIBITOR CONTAINING AN IMIDAZOLE-DERIVED PEPTIDE BOND REPLACEMENT. CRYSTALLOGRAPHIC AND PHARMACOKINETIC ANALYSIS
1YTG 1997-03-12 2.3 SIV PROTEASE CRYSTALLIZED WITH PEPTIDE PRODUCT
6AXR 2018-09-12 2.3 Structure of the P122A mutant of the HIV-1 capsid protein
3LAK 2010-02-23 2.3 Crystal structure of HIV-1 reverse transcriptase in complex with N1-heterocycle pyrimidinedione non-nucleoside inhibitor
2QNQ 2008-04-15 2.3 HIV-1 Protease in complex with a chloro decorated pyrrolidine-based inhibitor
1GNM 1996-11-08 2.3 HIV-1 PROTEASE MUTANT WITH VAL 82 REPLACED BY ASP (V82D) COMPLEXED WITH U89360E (INHIBITOR)
1GNO 1996-11-08 2.3 HIV-1 PROTEASE (WILD TYPE) COMPLEXED WITH U89360E (INHIBITOR)
1HBV 1995-07-10 2.3 A CHECK ON RATIONAL DRUG DESIGN. CRYSTAL STRUCTURE OF A COMPLEX OF HIV-1 PROTEASE WITH A NOVEL GAMMA-TURN MIMETIC
5OI3 2018-03-07 2.3 Dissociation of biochemical and antiretroviral activities of Integrase-LEDGF Allosteric Inhibitors revealed by resistance of A125 polymorphic HIV-1
5D3G 2015-09-30 2.3 Structure of HIV-1 Reverse Transcriptase Bound to a Novel 38-mer Hairpin Template-Primer DNA Aptamer
4KV8 2013-07-31 2.3 Crystal structure of HIV RT in complex with BILR0355BS
1HOS 1993-10-31 2.3 INHIBITION OF HUMAN IMMUNODEFICIENCY VIRUS-1 PROTEASE BY A C2-SYMMETRIC PHOSPHINATE SYNTHESIS AND CRYSTALLOGRAPHIC ANALYSIS
4I2P 2013-01-16 2.3 Crystal structure of HIV-1 reverse transcriptase in complex with rilpivirine (TMC278) based analogue
1ZLF 2006-04-25 2.3 Crystal structure of a complex of mutant HIV-1 protease (A71V, V82T, I84V) with a hydroxyethylamine peptidomimetic inhibitor
4HVP 1990-04-15 2.3 Structure of complex of synthetic HIV-1 protease with a substrate-based inhibitor at 2.3 Angstroms resolution
3DYA 2008-11-25 2.3 HIV-1 RT with non-nucleoside inhibitor annulated Pyrazole 1
1HIW 1996-10-14 2.3 TRIMERIC HIV-1 MATRIX PROTEIN
2OPS 2007-05-22 2.3 Crystal Structure of Y188C Mutant HIV-1 Reverse Transcriptase in Complex with GW420867X.
1HPS 1994-08-31 2.3 RATIONAL DESIGN, SYNTHESIS AND CRYSTALLOGRAPHIC ANALYSIS OF A HYDROXYETHYLENE-BASED HIV-1 PROTEASE INHIBITOR CONTAINING A HETEROCYCLIC P1'-P2' AMIDE BOND ISOSTERE
1HXB 1997-03-12 2.3 HIV-1 proteinase complexed with RO 31-8959
1TCX 1996-12-07 2.3 HIV TRIPLE MUTANT PROTEASE COMPLEXED WITH INHIBITOR SB203386
2RKI 2008-04-22 2.3 Crystal Structure of HIV-1 Reverse Transcriptase (RT) in Complex with a triazole derived NNRTI
4K4P 2013-09-18 2.31 TL-3 inhibited Trp6Ala HIV Protease
2Z54 2008-07-01 2.31 The Influence of I47A Mutation on Reduced Susceptibility to the Protease Inhibitor Lopinavir
5VQY 2017-08-23 2.35 Crystal Structure of HIV-1 Reverse Transcriptase (K103N, Y181C) Variant in Complex with N-(6-cyano-3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)-4-methylnaphthalen-1-yl)-N-methylacrylamide (JLJ684), a Non-nucleoside Inhibitor
4EJ8 2013-05-01 2.35 Apo HIV Protease (PR) dimer in closed form with fragment 1F1 in the outside/top of flap
5OI8 2018-03-07 2.35 Dissociation of biochemical and antiretroviral activities of Integrase-LEDGF Allosteric Inhibitors revealed by resistance of A125 polymorphic HIV-1
1RTJ 1996-04-03 2.35 MECHANISM OF INHIBITION OF HIV-1 REVERSE TRANSCRIPTASE BY NON-NUCLEOSIDE INHIBITORS
4CPQ 2014-12-17 2.35 Macrocyclic Transition-State Mimicking HIV-1 Protease Inhibitors Encompassing a Tertiary Alcohol
1AK4 1997-10-15 2.36 HUMAN CYCLOPHILIN A BOUND TO THE AMINO-TERMINAL DOMAIN OF HIV-1 CAPSID
2YNF 2013-01-09 2.36 HIV-1 Reverse Transcriptase Y188L mutant in complex with inhibitor GSK560
4O5B 2014-07-02 2.37 HIV-1 Integrase Catalytic Core Domain Complexed with Allosteric Inhibitor (2S)-tert-butoxy[6-(5-chloro-1H-benzimidazol-2-yl)-2,5-dimethyl-4-phenylpyridin-3-yl]ethanoic acid
5XN2 2018-02-07 2.38 HIV-1 reverse transcriptase Q151M:DNA:dGTP ternary complex
6ECL 2019-08-21 2.38 Crystal Structure of a 1,2,4-Triazole Allosteric RNase H Inhibitor in Complex with HIV Reverse Transcriptase
6EWA 2018-11-07 2.39 Crystal structure of HLA-A2 in complex with LILRB1
5VQX 2017-08-23 2.4 Crystal Structure of HIV-1 Reverse Transcriptase (Y181C) Variant in Complex with 2-chloro-N-(6-cyano-3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)-4-methylnaphthalen-1-yl)-N-methylacetamide (JLJ686), a Non-nucleoside Inhibitor
6CQL 2018-06-06 2.4 Crystal structure of F24 TCR -DR11-RQ13 peptide complex
6AXW 2018-09-12 2.4 Structure of the I124A mutant of the HIV-1 capsid protein
6AXS 2018-09-12 2.4 Structure of the V11I/T58A/P122A mutant of the HIV-1 capsid protein
5K14 2016-06-29 2.4 HIV-1 Reverse Transcriptase in complex with a 2,6-difluorophenyl DAPY analog
7HVP 1993-07-15 2.4 X-RAY CRYSTALLOGRAPHIC STRUCTURE OF A COMPLEX BETWEEN A SYNTHETIC PROTEASE OF HUMAN IMMUNODEFICIENCY VIRUS 1 AND A SUBSTRATE-BASED HYDROXYETHYLAMINE INHIBITOR
1VIJ 1999-01-13 2.4 HIV-1 PROTEASE COMPLEXED WITH THE INHIBITOR HOE/BAY 793 HEXAGONAL FORM
6CPO 2018-06-06 2.4 Crystal structure of DR15 presenting the RQ13 peptide
1VIK 1998-12-09 2.4 HIV-1 PROTEASE COMPLEXED WITH THE INHIBITOR HOE/BAY 793 ORTHORHOMBIC FORM
3DS5 2008-09-02 2.4 HIV-1 capsid C-terminal domain mutant (N183A)
6AYA 2018-09-12 2.4 Structure of the native full-length HIV-1 capsid protein in complex with Nup153 peptide
6AXT 2018-09-12 2.4 Structure of the T58S/T107I/P122A mutant of the HIV-1 capsid protein
3MEE 2010-05-12 2.4 HIV-1 Reverse Transcriptase in Complex with TMC278
5OI5 2018-03-07 2.4 Dissociation of biochemical and antiretroviral activities of Integrase-LEDGF Allosteric Inhibitors revealed by resistance of A125 polymorphic HIV-1
1K6Y 2001-12-21 2.4 Crystal Structure of a Two-Domain Fragment of HIV-1 Integrase
1S1T 2004-06-29 2.4 Crystal structure of L100I mutant HIV-1 reverse transcriptase in complex with UC-781
1VRU 1996-04-03 2.4 HIGH RESOLUTION STRUCTURES OF HIV-1 RT FROM FOUR RT-INHIBITOR COMPLEXES
3T1A 2011-10-26 2.4 Crystal Structure of HIV-1 Reverse Transcriptase (K103N mutant) in Complex with Inhibitor M05
1HRH 1992-01-15 2.4 CRYSTAL STRUCTURE OF THE RIBONUCLEASE H DOMAIN OF HIV-1 REVERSE TRANSCRIPTASE
1Q94 2004-06-01 2.4 Structures of HLA-A*1101 in complex with immunodominant nonamer and decamer HIV-1 epitopes clearly reveal the presence of a middle anchor residue
2RF2 2008-01-01 2.4 HIV reverse transcriptase in complex with inhibitor 7e (NNRTI)
4G8G 2013-03-20 2.4 Crystal Structure of C12C TCR-HA B2705-KK10
6B2G 2018-09-26 2.41 P38A mutant of HIV-1 capsid protein
6IK9 2019-01-30 2.43 HIV-1 reverse transcriptase with Q151M/G112S/D113A/Y115F/F116Y/F160L/I159L:DNA:dGTP ternary complex
5J2M 2016-08-03 2.43 HIV-1 reverse transcriptase in complex with DNA and EFdA-triphosphate, a translocation-defective RT inhibitor
4XFX 2015-06-10 2.43 Structure of the native full-length HIV-1 capsid protein
2BE2 2005-12-06 2.43 Crystal structure of HIV-1 reverse transcriptase (RT) in complex with R221239
4EJL 2013-05-01 2.44 Apo HIV Protease (PR) dimer in closed form with fragment 1F1-N in the outside/top of flap
6BSG 2018-01-03 2.44 Structure of HIV-1 RT complexed with RNA/DNA hybrid in an RNA hydrolysis-off mode
1SJE 2004-08-17 2.45 HLA-DR1 complexed with a 16 residue HIV capsid peptide bound in a hairpin conformation
6CPL 2018-06-06 2.45 Crystal structure of DR11 presenting the gag293 epitope
4QLH 2014-08-06 2.45 Crystal structure of drug resistant V82S/V1082S HIV-1 Protease
4DMN 2012-03-21 2.45 HIV-1 Integrase Catalytical Core Domain
5XN1 2018-02-07 2.45 HIV-1 reverse transcriptase Q151M:DNA:entecavir-triphosphate ternary complex
4COE 2014-12-10 2.45 Macrocyclic Transition-State Mimicking HIV-1 Protease Inhibitors Encompassing a Tertiary Alcohol
1M0B 2004-01-13 2.45 HIV-1 protease in complex with an ethyleneamine inhibitor
2YNI 2013-01-09 2.49 HIV-1 Reverse Transcriptase in complex with inhibitor GSK952
4WE1 2014-12-03 2.49 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with 5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)-2-naphthonitrile (JLJ600)
1C1B 2000-07-21 2.5 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH GCA-186
3ISN 2010-03-16 2.5 Crystal structure of HIV-1 RT bound to A 6-vinylpyrimidine inhibitor
2AZ9 2006-02-28 2.5 HIV-1 Protease NL4-3 1X mutant
3GGA 2009-05-26 2.5 HIV Protease inhibitors with pseudo-symmetric cores
2HND 2006-09-05 2.5 Crystal Structure of K101E Mutant HIV-1 Reverse Transcriptase in Complex with Nevirapine
8HVP 1993-10-31 2.5 STRUCTURE AT 2.5-ANGSTROMS RESOLUTION OF CHEMICALLY SYNTHESIZED HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 PROTEASE COMPLEXED WITH A HYDROXYETHYLENE*-BASED INHIBITOR
5IM7 2016-10-05 2.5 Crystal structure of HLA-B5801, a protective HLA allele for HIV-1 infection
1HPO 1997-04-21 2.5 HIV-1 PROTEASE TRIPLE MUTANT/U103265 COMPLEX
1D4S 1999-10-12 2.5 HIV-1 PROTEASE V82F/I84V DOUBLE MUTANT/TIPRANAVIR COMPLEX
1BDQ 1998-08-12 2.5 HIV-1 (2:31-37, 47, 82) PROTEASE COMPLEXED WITH INHIBITOR SB203386
2Q64 2008-02-26 2.5 HIV-1 PR mutant in complex with nelfinavir
1A8G 1998-07-15 2.5 HIV-1 PROTEASE IN COMPLEX WITH SDZ283-910
3N3I 2010-06-09 2.5 Crystal Structure of G48V/C95F tethered HIV-1 Protease/Saquinavir complex
3P05 2011-01-12 2.5 X-ray structure of pentameric HIV-1 CA
5TSV 2017-11-08 2.5 HIV-1 CA hexamer with NUP153 peptide - R3 crystal form
6CQN 2018-06-06 2.5 Crystal structure of F5 TCR -DR11-RQ13 peptide complex
1C1C 2000-07-21 2.5 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH TNK-6123
1JLA 2001-10-03 2.5 CRYSTAL STRUCTURE OF Y181C MUTANT HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH TNK-651
5TXL 2017-04-05 2.5 STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE (RT) TERNARY COMPLEX WITH A DOUBLE STRANDED DNA AND AN INCOMING DATP
3DLE 2008-08-12 2.5 Crystal structure of hiv-1 reverse transcriptase in complex with GF128590.
5VQS 2017-08-23 2.5 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with N-(6-cyano-3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)-4-methylnaphthalen-1-yl)acrylamide (JLJ685), a Non-nucleoside Inhibitor
3AID 1997-09-17 2.5 A NEW CLASS OF HIV-1 PROTEASE INHIBITOR: THE CRYSTALLOGRAPHIC STRUCTURE, INHIBITION AND CHEMICAL SYNTHESIS OF AN AMINIMIDE PEPTIDE ISOSTERE
6AMO 2018-08-15 2.5 STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE (RT) TERNARY COMPLEX WITH A DOUBLE STRANDED DNA AND AN INCOMING D4TTP AT PH 7.0
1BI4 1998-11-04 2.5 CATALYTIC DOMAIN OF HIV-1 INTEGRASE
3MED 2010-05-12 2.5 HIV-1 K103N Reverse Transcriptase in Complex with TMC125
1JKH 2001-10-03 2.5 CRYSTAL STRUCTURE OF Y181C MUTANT HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH DMP-266(EFAVIRENZ)
2IAJ 2006-12-19 2.5 Crystal Structure of K103N/Y181C Mutant HIV-1 Reverse Transcriptase (RT) in Complex with ATP
2HNY 2006-09-05 2.5 Crystal Structure of E138K Mutant HIV-1 Reverse Transcriptase in Complex with Nevirapine
1HHJ 1993-10-31 2.5 THE ANTIGENIC IDENTITY OF PEPTIDE(SLASH)MHC COMPLEXES: A COMPARISON OF THE CONFORMATION OF FIVE PEPTIDES PRESENTED BY HLA-A2
1EP4 2000-09-27 2.5 Crystal structure of HIV-1 reverse transcriptase in complex with S-1153
1AAQ 1994-06-22 2.5 HYDROXYETHYLENE ISOSTERE INHIBITORS OF HUMAN IMMUNODEFICIENCY VIRUS-1 PROTEASE: STRUCTURE-ACTIVITY ANALYSIS USING ENZYME KINETICS, X-RAY CRYSTALLOGRAPHY, AND INFECTED T-CELL ASSAYS
2BPZ 1999-02-23 2.5 HIV-1 protease-inhibitor complex
1MTB 2003-01-07 2.5 Viability of a drug-resistant HIV-1 protease mutant: structural insights for better antiviral therapy
6B2I 2018-09-26 2.5 E45A mutant of the HIV-1 capsid protein
1SH9 2004-10-05 2.5 Comparing the Accumulation of Active Site and Non-active Site Mutations in the HIV-1 Protease
5VQW 2017-08-23 2.5 Crystal Structure of HIV-1 Reverse Transcriptase (Y181C) Variant in Complex with N-(6-cyano-3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)-4-methylnaphthalen-1-yl)acrylamide (JLJ685), a Non-nucleoside Inhibitor
1BIU 1998-08-19 2.5 HIV-1 INTEGRASE CORE DOMAIN COMPLEXED WITH MG++
4IG0 2013-02-06 2.5 HIV-1 reverse transcriptase with bound fragment at the 507 site
6AVM 2018-08-15 2.5 STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE (RT) TERNARY COMPLEX WITH A DOUBLE STRANDED DNA AND AN INCOMING D4TTP AT PH 9.5 WITH CROSS-LINKING TO SECOND BASE TEMPLATE OVERHANG
4I7F 2013-02-20 2.5 HIV-1 Reverse Transcriptase in complex with a phosphonate analog of nevirapine
1FK9 2000-11-03 2.5 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH DMP-266(EFAVIRENZ)
6AY9 2018-09-12 2.5 Structure of the native full-length HIV-1 capsid protein in complex with CPSF6 peptide
3TAM 2011-10-26 2.51 Crystal structure of HIV-1 reverse transcriptase (K103N mutant) in complex with inhibitor M06
3LAL 2010-02-23 2.51 Crystal structure of HIV-1 reverse transcriptase in complex with N1-ethyl pyrimidinedione non-nucleoside inhibitor
4PQU 2014-06-18 2.51 Crystal structure of HIV-1 Reverse Transcriptase in complex with RNA/DNA and dATP
1C0U 2000-07-19 2.52 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH BM+50.0934
6OR7 2019-07-24 2.53 Structure of HIV-1 Reverse Transcriptase (RT) in complex with DNA AND (-)FTC-TP
5J2P 2016-08-03 2.53 HIV-1 reverse transcriptase in complex with DNA that has incorporated EFdA-MP at the P-(post-translocation) site and a second EFdA-MP at the N-(pre-translocation) site
1RT2 1997-04-21 2.55 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH TNK-651
5VQQ 2017-08-23 2.55 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with N-(6-cyano-3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)-4-methylnaphthalen-1-yl)-2-fluoro-N-methylacetamide (JLJ683), a Non-nucleoside Inhibitor
2OPP 2007-05-22 2.55 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with GW420867X.
1RT1 1997-04-21 2.55 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH MKC-442
2R05 2007-12-18 2.55 Crystal Structure of ALIX/AIP1 in complex with the HIV-1 YPLASL Late Domain
3LAN 2010-02-23 2.55 Crystal structure of HIV-1 reverse transcriptase in complex with N1-butyl pyrimidinedione non-nucleoside inhibitor
6P1X 2019-07-24 2.55 Structure of HIV-1 Reverse Transcriptase (RT) in complex with dsDNA and L-ddCTP
3IS9 2010-04-07 2.55 Crystal structure of the HIV-1 reverse transcriptase (RT) in complex with the alkenyldiarylmethane (ADAM) Non-nucleoside RT Inhibitor dimethyl 3,3'-(6-methoxy-6-oxohex-1-ene-1,1-diyl)bis(5-cyano-6-methoxybenzoate).
5VQR 2017-08-23 2.55 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with N-(6-cyano-3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)-4-methylnaphthalen-1-yl)-N-methylacrylamide (JLJ684), a Non-nucleoside Inhibitor
5TXN 2017-04-05 2.55 STRUCTURE OF Q151M MUTANT HIV-1 REVERSE TRANSCRIPTASE (RT) TERNARY COMPLEX WITH A DOUBLE STRANDED DNA AND AN INCOMING DATP
5TXO 2017-04-05 2.55 STRUCTURE OF Q151M complex (A62V, V75I, F77L, F116Y, Q151M) mutant HIV-1 REVERSE TRANSCRIPTASE (RT) TERNARY COMPLEX WITH A DOUBLE STRANDED DNA AND AN INCOMING DATP
5VQT 2017-08-23 2.56 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with 2-chloro-N-(6-cyano-3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)-4-methylnaphthalen-1-yl)-N-methylacetamide (JLJ686), a Non-nucleoside Inhibitor
4NCG 2014-02-12 2.58 Discovery of Doravirine, an orally bioavailable non-nucleoside reverse transcriptase inhibitor potent against a wide range of resistant mutant HIV viruses
5VQV 2017-08-23 2.58 Crystal Structure of HIV-1 Reverse Transcriptase (Y181C) Variant in Complex with N-(6-cyano-3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)-4-methylnaphthalen-1-yl)-N-methylacrylamide (JLJ684), a Non-nucleoside Inhibitor
6ANQ 2018-08-15 2.59 STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE (RT) TERNARY COMPLEX WITH A DOUBLE STRANDED DNA AND AN INCOMING D4TTP AT PH 8.5
4WYM 2014-12-17 2.6 Structural basis of HIV-1 capsid recognition by CPSF6
3FFI 2009-12-15 2.6 HIV-1 RT with pyridone non-nucleoside inhibitor
6AXX 2018-09-12 2.6 Structure of the T58A/I124A mutant of the HIV-1 capsid protein
1JLG 2001-10-03 2.6 CRYSTAL STRUCTURE OF Y188C MUTANT HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH UC-781
6AVT 2018-08-15 2.6 STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE (RT) TERNARY COMPLEX WITH A DOUBLE STRANDED DNA AND AN INCOMING D4TTP AT PH 9.5 WITH CROSS-LINKING TO FIRST BASE TEMPLATE OVERHANG
1REV 1996-10-14 2.6 HIV-1 REVERSE TRANSCRIPTASE
3T19 2011-10-26 2.6 Crystal structure of HIV-1 reverse transcriptase (wild type) in complex with inhibitor M05
1BAJ 1998-10-14 2.6 HIV-1 CAPSID PROTEIN C-TERMINAL FRAGMENT PLUS GAG P2 DOMAIN
3DRP 2008-10-14 2.6 HIV reverse transcriptase in complex with inhibitor R8e
4ZHR 2015-11-11 2.6 Structure of HIV-1 RT Q151M mutant
6AN8 2018-08-15 2.6 STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE (RT) TERNARY COMPLEX WITH A DOUBLE STRANDED DNA AND AN INCOMING D4TTP AT PH 8.0
1TKT 2004-12-07 2.6 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH GW426318
1S1V 2004-06-29 2.6 Crystal structure of L100I mutant HIV-1 reverse transcriptase in complex with TNK-651
1S9E 2004-05-11 2.6 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE (RT) IN COMPLEX WITH JANSSEN-R129385
1FB7 2000-12-13 2.6 CRYSTAL STRUCTURE OF AN IN VIVO HIV-1 PROTEASE MUTANT IN COMPLEX WITH SAQUINAVIR: INSIGHTS INTO THE MECHANISMS OF DRUG RESISTANCE
5XN0 2018-02-07 2.6 HIV-1 reverse transcriptase Q151M:DNA binary complex
3QO9 2011-05-04 2.6 Crystal structure of HIV-1 Reverse Transcriptase (RT) in complex with TSAO-T, a non-nucleoside RT inhibitor (NNRTI)
1A43 1999-02-09 2.6 STRUCTURE OF THE HIV-1 CAPSID PROTEIN DIMERIZATION DOMAIN AT 2.6A RESOLUTION
5VQU 2017-08-23 2.6 Crystal Structure of HIV-1 Reverse Transcriptase (Y181C) Variant in Complex with N-(6-cyano-3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)-4-methylnaphthalen-1-yl)-2-fluoro-N-methylacetamide (JLJ683), a Non-nucleoside Inhibitor
5C24 2015-07-29 2.6 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with 7-((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-6,8-dimethylindolizine-2-carbonitrile (JLJ605), a non-nucleoside inhibitor
2ITG 1997-03-12 2.6 CATALYTIC DOMAIN OF HIV-1 INTEGRASE: ORDERED ACTIVE SITE IN THE F185H CONSTRUCT
6B2H 2018-09-26 2.6 P38A/T216I mutant of the HIV-1 capsid protein
6IKA 2019-01-30 2.6 HIV-1 reverse transcriptase with Q151M/G112S/D113A/Y115F/F116Y/F160L/I159L:DNA:entecavir-triphosphate ternary complex
1JLF 2001-10-03 2.6 CRYSTAL STRUCTURE OF Y188C MUTANT HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE
2R02 2007-12-18 2.6 Crystal Structure of ALIX/AIP1 in complex with the HIV-1 YPLTSL Late Domain
6ASW 2018-08-15 2.61 STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE (RT) TERNARY COMPLEX WITH A DOUBLE STRANDED DNA AND AN INCOMING D4TTP AT PH 9.0
6GL1 2018-08-08 2.62 HLA-E*01:03 in complex with the HIV epitope, RL9HIV
1LWC 2002-10-30 2.62 CRYSTAL STRUCTURE OF M184V MUTANT HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE
4RW6 2015-04-29 2.63 Crystal Structure of HIV-1 Reverse Transcriptase (Y181C) variant in complex with (E)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (JLJ494), a Non-nucleoside Inhibitor
5EU7 2016-09-28 2.64 Crystal structure of HIV-1 integrase catalytic core in complex with Fab
3KLI 2010-09-22 2.65 Crystal structure of unliganded AZT-resistant HIV-1 Reverse Transcriptase
6BSH 2018-01-03 2.65 Structure of HIV-1 RT complexed with RNA/DNA hybrid in the RNA hydrolysis mode
1KLM 1998-03-18 2.65 HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH BHAP U-90152
3DI6 2008-08-19 2.65 HIV-1 RT with pyridazinone non-nucleoside inhibitor
2B6A 2005-11-01 2.65 Crystal structure of HIV-1 reverse transcriptase (RT) in complex with THR-50
4GW6 2013-05-01 2.65 HIV-1 Integrase Catalytic Core Domain Complexed with Allosteric Inhibitor
6OUN 2019-07-24 2.66 Structure of HIV-1 Reverse Transcriptase (RT) in complex with dsDNA and (-)3TC-TP
3M8P 2010-05-19 2.67 HIV-1 RT with NNRTI TMC-125
4RW4 2015-04-29 2.67 Crystal Structure of HIV-1 Reverse Transcriptase (K103N,Y181C) variant in complex with (E)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (JLJ494), a Non-nucleoside Inhibitor
4KSE 2014-08-13 2.68 Crystal structure of a HIV p51 (219-230) deletion mutant
6BHT 2018-08-01 2.69 HIV-1 CA hexamer in complex with IP6, orthorhombic crystal form
4LSL 2013-12-25 2.69 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with (E)-3-(3-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (JLJ476), a non-nucleoside inhibitor
3H4E 2009-06-23 2.7 X-ray Structure of Hexameric HIV-1 CA
1HQE 2001-05-30 2.7 HUMAN IMMUNODEFICIENCY VIRUS TYPE 1
3PHV 1992-01-15 2.7 X-RAY ANALYSIS OF HIV-1 PROTEINASE AT 2.7 ANGSTROMS RESOLUTION CONFIRMS STRUCTURAL HOMOLOGY AMONG RETROVIRAL ENZYMES
5TXM 2017-04-05 2.7 STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE (RT) TERNARY COMPLEX WITH A DOUBLE STRANDED DNA AND AN INCOMING DDATP
3M8Q 2010-05-19 2.7 HIV-1 RT with AMINOPYRIMIDINE NNRTI
3KK1 2010-03-23 2.7 HIV-1 reverse transcriptase-DNA complex with nuceotide inhibitor GS-9148-diphosphate bound in nucleotide site
5TER 2017-01-11 2.7 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with 5-chloro-7-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)-8-methyl-2-naphthonitrile (JLJ651), a Non-nucleoside Inhibitor
3C6U 2008-04-22 2.7 Crystal Structure of HIV Reverse Transcriptase in complex with inhibitor 22
5TUQ 2017-06-28 2.7 Crystal Structure of a 6-Cyclohexylmethyl-3-hydroxypyrimidine-2,4-dione Inhibitor in Complex with HIV Reverse Transcriptase
1S1W 2004-06-29 2.7 Crystal structure of V106A mutant HIV-1 reverse transcriptase in complex with UC-781
1HHP 1992-10-15 2.7 THE THREE-DIMENSIONAL STRUCTURE OF THE ASPARTYL PROTEASE FROM THE HIV-1 ISOLATE BRU
2FDE 2006-02-21 2.7 Wild type HIV protease bound with GW0385
3QLH 2011-12-21 2.7 HIV-1 Reverse Transcriptase in Complex with Manicol at the RNase H Active Site and TMC278 (Rilpivirine) at the NNRTI Binding Pocket
6AN2 2018-08-15 2.7 STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE (RT) TERNARY COMPLEX WITH A DOUBLE STRANDED DNA AND AN INCOMING D4TTP AT PH 7.5
3V6D 2012-01-18 2.7 Crystal structure of HIV-1 reverse transcriptase (RT) cross-linked with AZT-terminated DNA
3DS3 2008-09-02 2.7 HIV-1 capsid C-terminal domain mutant (Y169A) in complex with an inhibitor of particle assembly (CAI)
1C0T 2000-07-19 2.7 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH BM+21.1326
1DLO 1996-08-01 2.7 HUMAN IMMUNODEFICIENCY VIRUS TYPE 1
4XFZ 2015-06-10 2.7 Structure of the native full-length HIV-1 capsid protein in complex with PF-3450074 (PF74)
4I2Q 2013-01-16 2.7 Crystal structure of K103N/Y181C mutant of HIV-1 reverse transcriptase in complex with rilpivirine (TMC278) analogue
5TXP 2017-04-05 2.7 STRUCTURE OF Q151M complex (A62V, V75I, F77L, F116Y, Q151M) mutant HIV-1 REVERSE TRANSCRIPTASE (RT) TERNARY COMPLEX WITH A DOUBLE STRANDED DNA AND AN INCOMING DDATP
3C6T 2008-04-22 2.7 Crystal Structure of HIV Reverse Transcriptase in complex with inhibitor 14
1HQU 2001-05-30 2.7 HUMAN IMMUNODEFICIENCY VIRUS TYPE 1
3I0S 2009-08-25 2.7 crystal structure of HIV reverse transcriptase in complex with inhibitor 7
3GGX 2009-05-26 2.7 HIV Protease, pseudo-symmetric inhibitors
4O4G 2014-11-05 2.71 Crystal Structure of HIV-1 Reverse Transcriptase in complex with 4-((4-(mesitylamino)-1,3,5-triazin-2-yl)amino)benzonitrile (JLJ527), a non-nucleoside inhibitor
1EET 2001-02-07 2.73 HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH THE INHIBITOR MSC204
6P1I 2019-07-24 2.74 Structure of HIV-1 Reverse Transcriptase (RT) in complex with dsDNA and dCTP
6DTW 2019-07-31 2.74 HIV-1 Reverse Transcriptase Y181C Mutant in complex with JLJ 578
5NMG 2017-11-15 2.75 868 TCR in complex with HLA A02 presenting SLYFNTIAVL
5HRO 2016-06-01 2.75 STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE In COMPLEX WITH A DNA aptamer and an Alpha-carboxy nucleoside phosphonate inhibitor (alpha-CNP)
6CQJ 2018-06-06 2.75 Crystal structure of DR1 presenting the RQ13 peptide
5O2U 2017-06-21 2.76 Llama VHH in complex with p24
3LAM 2010-02-23 2.76 Crystal structure of HIV-1 reverse transcriptase in complex with N1-propyl pyrimidinedione non-nucleoside inhibitor
6AXV 2018-09-12 2.77 Structure of the T58S/T107I/P122A mutant of the HIV-1 capsid protein in complex with PF-3450074 (PF74)
6AXY 2018-09-12 2.78 Structure of the V11I/T58A/I124A mutant of the HIV-1 capsid protein
5J2Q 2016-08-03 2.79 HIV-1 reverse transcriptase in complex with DNA that has incorporated a mismatched EFdA-MP at the N-(pre-translocation) site
3LP0 2010-06-09 2.79 HIV-1 reverse transcriptase with inhibitor
5XOT 2017-06-14 2.79 Crystal structure of pHLA-B35 in complex with TU55 T cell receptor
4DQG 2012-03-07 2.79 Crystal Structure of apo(G16C/L38C) HIV-1 Protease
1RT6 1999-07-29 2.8 HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH UC38
6CQQ 2018-06-06 2.8 Crystal structure of F24 TCR -DR15-RQ13 peptide complex
3LP3 2010-06-09 2.8 p15 HIV RNaseH domain with inhibitor MK3
1R0A 2004-08-03 2.8 Crystal structure of HIV-1 reverse transcriptase covalently tethered to DNA template-primer solved to 2.8 angstroms
3MEG 2010-05-12 2.8 HIV-1 K103N Reverse Transcriptase in Complex with TMC278
2BPX 1999-02-23 2.8 HIV-1 protease-inhibitor complex
1HNI 1995-06-03 2.8 STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN A COMPLEX WITH THE NONNUCLEOSIDE INHIBITOR ALPHA-APA R 95845 AT 2.8 ANGSTROMS RESOLUTION
3D3T 2008-07-08 2.8 Crystal Structure of HIV-1 CRF01_AE in complex with the substrate p1-p6
3S85 2012-04-11 2.8 Discovery of New HIV Protease Inhibitors with Potential for Convenient Dosing and Reduced Side Effects: A-790742 and A-792611.
1DTQ 2000-03-20 2.8 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH PETT-1 (PETT131A94)
1JLE 2001-10-03 2.8 CRYSTAL STRUCTURE OF Y188C MUTANT HIV-1 REVERSE TRANSCRIPTASE
3HVP 1989-10-15 2.8 CONSERVED FOLDING IN RETROVIRAL PROTEASES. CRYSTAL STRUCTURE OF A SYNTHETIC HIV-1 PROTEASE
3V4I 2012-01-18 2.8 Crystal structure of HIV-1 reverse transcriptase (RT) with DNA and AZTTP
1HTE 1994-07-31 2.8 X-RAY CRYSTALLOGRAPHIC STUDIES OF A SERIES OF PENICILLIN-DERIVED ASYMMETRIC INHIBITORS OF HIV-1 PROTEASE
9HVP 1992-04-15 2.8 Design, activity and 2.8 Angstroms crystal structure of a C2 symmetric inhibitor complexed to HIV-1 protease
2BPW 1999-02-23 2.8 HIV-1 protease-inhibitor complex
4XFY 2015-06-10 2.8 Structure of the native full-length dehydrated HIV-1 capsid protein
1EX4 2000-06-07 2.8 HIV-1 INTEGRASE CATALYTIC CORE AND C-TERMINAL DOMAIN
1LWF 2002-10-30 2.8 CRYSTAL STRUCTURE OF A MUTANT HIV-1 REVERSE TRANSCRIPTASE (RTMQ+M184V: M41L/D67N/K70R/M184V/T215Y) IN COMPLEX WITH NEVIRAPINE
3LP2 2010-06-09 2.8 HIV-1 reverse transcriptase with inhibitor
1RDH 1994-05-31 2.8 CRYSTALLOGRAPHIC ANALYSES OF AN ACTIVE HIV-1 RIBONUCLEASE H DOMAIN SHOW STRUCTURAL FEATURES THAT DISTINGUISH IT FROM THE INACTIVE FORM
2HMI 1998-10-14 2.8 HIV-1 REVERSE TRANSCRIPTASE/FRAGMENT OF FAB 28/DNA COMPLEX
3IG1 2010-01-26 2.8 HIV-1 Reverse Transcriptase with the Inhibitor beta-Thujaplicinol Bound at the RNase H Active Site
1TV6 2004-07-20 2.8 HIV-1 Reverse Transcriptase Complexed with CP-94,707
2WON 2010-08-11 2.8 Crystal Structure of UK-453061 bound to HIV-1 Reverse Transcriptase (wild-type).
1BDR 1998-10-14 2.8 HIV-1 (2: 31, 33-37) PROTEASE COMPLEXED WITH INHIBITOR SB203386
3IRX 2010-04-07 2.8 Crystal Structure of HIV-1 reverse transcriptase (RT) in complex with the Non-nucleoside RT Inhibitor (E)-S-Methyl 5-(1-(3,7-Dimethyl-2-oxo-2,3-dihydrobenzo[d]oxazol-5-yl)-5-(5-methyl-1,3,4-oxadiazol-2-yl)pent-1-enyl)-2-methoxy-3-methylbenzothioate.
1TL3 2004-12-07 2.8 Crystal structure of hiv-1 reverse transcriptase in complex with gw450557
3ITH 2010-03-16 2.8 Crystal structure of the HIV-1 reverse transcriptase bound to a 6-vinylpyrimidine inhibitor
1BDL 1998-08-12 2.8 HIV-1 (2:31-37) PROTEASE COMPLEXED WITH INHIBITOR SB203386
1IKX 2001-06-06 2.8 K103N Mutant HIV-1 Reverse Transcriptase in Complex with the Inhibitor PNU142721
1S1X 2004-06-29 2.8 Crystal structure of V108I mutant HIV-1 reverse transcriptase in complex with nevirapine
1S9G 2004-05-11 2.8 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE (RT) IN COMPLEX WITH JANSSEN-R120394.
4U0B 2014-11-12 2.8 Hexamer HIV-1 CA in complex with CPSF6 peptide, P212121 crystal form
2VG5 2007-12-11 2.8 Crystal structures of HIV-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
2OPQ 2007-05-22 2.8 Crystal Structure of L100I Mutant HIV-1 Reverse Transcriptase in Complex with GW420867X.
1LW0 2002-10-30 2.8 CRYSTAL STRUCTURE OF T215Y MUTANT HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE
1LWE 2002-10-30 2.81 CRYSTAL STRUCTURE OF M41L/T215Y MUTANT HIV-1 REVERSE TRANSCRIPTASE (RTMN) IN COMPLEX WITH NEVIRAPINE
6BHJ 2018-10-31 2.81 Structure of HIV-1 Reverse Transcriptase Bound to a 38-mer Hairpin Template-Primer RNA-DNA Aptamer
1TKZ 2004-12-07 2.81 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH GW429576
2VG7 2007-12-11 2.82 Crystal structures of HIV-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
5C25 2015-07-29 2.84 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with 6-((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-5,7-dimethyl-2-naphthonitrile (JLJ639), a Non-nucleoside Inhibitor
5TW3 2017-03-15 2.85 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with 5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)-4-fluorophenoxy)-7-fluoro-2-naphthonitrile (JLJ636), a Non-nucleoside Inhibitor
3V81 2012-01-18 2.85 Crystal structure of HIV-1 reverse transcriptase (RT) with DNA and the nonnucleoside inhibitor nevirapine
4H4M 2012-12-05 2.85 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with (E)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (JLJ494), a Non-nucleoside Inhibitor
1QE1 1999-08-30 2.85 CRYSTAL STRUCTURE OF 3TC-RESISTANT M184I MUTANT OF HIV-1 REVERSE TRANSCRIPTASE
1TKX 2004-12-07 2.85 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH GW490745
6OTZ 2019-07-24 2.86 Structure of HIV-1 Reverse Transcriptase (RT) in complex with dsDNA and (+)FTC-TP
5V5M 2017-06-14 2.88 Crystal structure of HLA-B*5701 complex with HIV-1 gag derived peptide TW10
4MFB 2013-11-06 2.88 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (JLJ555), a non-nucleoside inhibitor
5INC 2016-10-05 2.88 Crystal structure of HLA-B5801, a protective HLA allele for HIV-1 infection
4RW8 2015-04-29 2.88 Crystal Structure of HIV-1 Reverse Transcriptase in complex with (E)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (JLJ532), a non-nucleoside inhibitor'
4KKO 2013-08-14 2.89 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with 4-((4-methoxy-6-(2-morpholinoethoxy)-1,3,5-triazin-2-yl)amino)-2-((3-methylbut-2-en-1-yl)oxy)benzonitrile (JLJ513), a non-nucleoside inhibitor
5NMF 2017-11-15 2.89 868 TCR in complex with HLA A02 presenting SLYNTIATL
6BSJ 2018-01-03 2.89 Structure of HIV-1 RT complexed with an RNA/DNA hybrid sequence non-preferred for RNA hydrolysis
4R5P 2015-03-11 2.89 Crystal structure of HIV-1 reverse transcriptase (RT) with DNA and a nucleoside triphosphate mimic alpha-carboxy nucleoside phosphonate inhibitor
4O44 2014-05-21 2.89 Crystal Structure of HIV-1 Reverse Transcriptase in complex with 4-((4-(mesitylamino)-6-(3-morpholinopropoxy)-1,3,5-triazin-2-yl)amino)benzonitrile (JLJ529), a non-nucleoside inhibitor
3DRR 2008-10-14 2.89 HIV reverse transcriptase Y181C mutant in complex with inhibitor R8e
5HP1 2016-06-01 2.9 STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE In COMPLEX WITH A DNA aptamer and FOSCARNET, a Pyrophosphate analog
3KK3 2010-03-23 2.9 HIV-1 reverse transcriptase-DNA complex with GS-9148 terminated primer
3DOK 2008-08-12 2.9 Crystal structure of K103N mutant HIV-1 reverse transcriptase in complex with GW678248.
5J1E 2016-06-15 2.9 Crystal Structure of a Hydroxypyridone Carboxylic Acid Active-Site RNase H Inhibitor in Complex with HIV Reverse Transcriptase
1TL1 2004-12-07 2.9 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH GW451211
1FKP 2000-11-03 2.9 CRYSTAL STRUCTURE OF NNRTI RESISTANT K103N MUTANT HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE
6OE3 2019-05-15 2.9 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with 5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)-7-fluoro-2-naphthonitrile (JLJ635), a Non-nucleoside Inhibitor
2YKM 2011-08-17 2.9 Crystal structure of HIV-1 Reverse Transcriptase (RT) in complex with a Difluoromethylbenzoxazole (DFMB) Pyrimidine Thioether derivative, a non-nucleoside RT inhibitor (NNRTI)
4PUO 2014-06-18 2.9 Crystal structure of HIV-1 reverse transcriptase in complex with RNA/DNA and Nevirapine
1RT4 1999-07-29 2.9 HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH UC781
1SV5 2004-05-11 2.9 CRYSTAL STRUCTURE OF K103N MUTANT HIV-1 REVERSE TRANSCRIPTASE (RT) IN COMPLEX WITH JANSSEN-R165335
1FKO 2000-11-03 2.9 CRYSTAL STRUCTURE OF NNRTI RESISTANT K103N MUTANT HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH DMP-266(EFAVIRENZ)
1S6P 2004-05-11 2.9 CRYSTAL STRUCTURE OF HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 REVERSE TRANSCRIPTASE (RT) IN COMPLEX WITH JANSSEN-R100943
5J2N 2016-08-03 2.9 HIV-1 reverse transcriptase in complex with DNA that has incorporated EFdA-MP at the P-(post-translocation) site and dTMP at the N-(pre-translocation) site
1KJ4 2002-03-06 2.9 SUBSTRATE SHAPE DETERMINES SPECIFICITY OF RECOGNITION RECOGNITION FOR HIV-1 PROTEASE: ANALYSIS OF CRYSTAL STRUCTURES OF SIX SUBSTRATE COMPLEXES
3KK2 2010-03-23 2.9 HIV-1 reverse transcriptase-DNA complex with dATP bound in the nucleotide binding site
2OPR 2007-05-22 2.9 Crystal Structure of K101E Mutant HIV-1 Reverse Transcriptase in Complex with GW420867X.
2YNH 2013-01-09 2.9 HIV-1 Reverse Transcriptase in complex with inhibitor GSK500
3HVT 1994-10-15 2.9 STRUCTURAL BASIS OF ASYMMETRY IN THE HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 REVERSE TRANSCRIPTASE HETERODIMER
1RT5 1999-07-29 2.9 HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH UC10
2B5J 2005-12-06 2.9 Crystal structure of HIV-1 reverse transcriptase (RT) in complex with JANSSEN-R165481
4H4O 2012-12-05 2.9 Crystal Structure of HIV-1 Reverse Transcriptase (RT) in Complex with (E)-3-(3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)- 4-fluorophenoxy)-5-fluorophenyl)acrylonitrile (JLJ506), A Non-nucleoside inhibitor
3KLH 2010-09-22 2.9 Crystal structure of AZT-Resistant HIV-1 Reverse Transcriptase crosslinked to post-translocation AZTMP-Terminated DNA (COMPLEX P)
2ZE2 2008-02-12 2.9 Crystal structure of L100I/K103N mutant HIV-1 reverse transcriptase (RT) in complex with TMC278 (rilpivirine), a non-nucleoside RT inhibitor
6BHR 2018-08-08 2.91 HIV-1 immature CTD-SP1 hexamer in complex with IP6
5NME 2017-11-15 2.94 868 TCR in complex with HLA A02 presenting SLYNTVATL
2BAN 2005-12-06 2.95 Crystal structure of HIV-1 reverse transcriptase (RT) in complex with JANSSEN-R157208
3E01 2008-11-25 2.95 HIV-RT with non-nucleoside inhibitor annulated pyrazole 2
3NBP 2010-08-18 2.95 HIV-1 reverse transcriptase with aminopyrimidine inhibitor 2
5HLF 2016-02-10 2.95 STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE In COMPLEX WITH A 38-MER HAIRPIN TEMPLATE-PRIMER DNA APTAMER AND AN ALPHA-CARBOXYPHOSPHONATE INHIBITOR
3I0R 2009-08-25 2.98 crystal structure of HIV reverse transcriptase in complex with inhibitor 3
4RW9 2015-04-29 2.99 Crystal Structure of HIV-1 Reverse Transcriptase (Y181C) variant in complex with (E)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (JLJ532), a non-nucleoside inhibitor
6P2G 2019-07-24 2.99 Structure of HIV-1 Reverse Transcriptase (RT) in complex with dsDNA and D-ddCTP
3JSM 2009-09-29 3.0 K65R mutant HIV-1 reverse transcriptase cross-linked to DS-DNA and complexed with tenofovir-diphosphate as the incoming nucleotide substrate
5UV5 2017-08-16 3.0 Crystal Structure of a 2-Hydroxyisoquinoline-1,3-dione RNase H Active Site Inhibitor with Multiple Binding Modes to HIV Reverse Transcriptase
4PWD 2014-06-18 3.0 Crystal structure of HIV-1 reverse transcriptase in complex with bulge-RNA/DNA and Nevirapine
1JLC 2001-10-03 3.0 CRYSTAL STRUCTURE OF Y181C MUTANT HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH PETT-2
1RT7 1999-07-29 3.0 HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH UC84
1HNV 1995-07-10 3.0 STRUCTURE OF HIV-1 RT(SLASH)TIBO R 86183 COMPLEX REVEALS SIMILARITY IN THE BINDING OF DIVERSE NONNUCLEOSIDE INHIBITORS
2HVP 1989-04-19 3.0 THREE-DIMENSIONAL STRUCTURE OF ASPARTYL PROTEASE FROM HUMAN IMMUNODEFICIENCY VIRUS HIV-1
1YT9 2005-04-12 3.0 HIV Protease with oximinoarylsulfonamide bound
1T05 2004-05-11 3.0 HIV-1 reverse transcriptase crosslinked to template-primer with tenofovir-diphosphate bound as the incoming nucleotide substrate
1S1U 2004-06-29 3.0 Crystal structure of L100I mutant HIV-1 reverse transcriptase in complex with nevirapine
5W5W 2018-06-20 3.0 HIV Protease (PR) in open form with Mg2+ in active site and HIVE-9 in eye site
1E28 2000-09-12 3.0 Nonstandard peptide binding of HLA-B*5101 complexed with HIV immunodominant epitope KM2(TAFTIPSI)
1N6Q 2003-01-14 3.0 HIV-1 Reverse Transcriptase Crosslinked to pre-translocation AZTMP-terminated DNA (complex N)
1AUM 1998-01-14 3.0 HIV CAPSID C-TERMINAL DOMAIN (CAC146)
1HYS 2001-03-26 3.0 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH A POLYPURINE TRACT RNA:DNA
1IKY 2001-06-06 3.0 HIV-1 Reverse Transcriptase in Complex with the Inhibitor MSC194
1HPZ 2001-05-30 3.0 HUMAN IMMUNODEFICIENCY VIRUS TYPE 1
1SUQ 2004-05-11 3.0 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE (RT) IN COMPLEX WITH JANSSEN-R185545
6N3J 2018-12-12 3.0 MicroED Structure of the CTD-SP1 fragment of HIV-1 Gag
1IKW 2001-06-06 3.0 Wild Type HIV-1 Reverse Transcriptase in Complex with Efavirenz
2IC3 2006-12-19 3.0 Crystal Structure of K103N/Y181C Mutant HIV-1 Reverse Transcriptase (RT) in Complex with Nonnucleoside Inhibitor HBY 097
1JLB 2001-10-03 3.0 CRYSTAL STRUCTURE OF Y181C MUTANT HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH NEVIRAPINE
1S6Q 2004-05-11 3.0 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE (RT) IN COMPLEX WITH JANSSEN-R147681
1TVR 1997-03-12 3.0 HIV-1 RT/9-CL TIBO
5I3U 2016-06-01 3.0 STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE N-SITE COMPLEX; CATALYTIC INCORPORATION OF AZTMP to A DNA aptamer in CRYSTAL
1DTT 2000-04-02 3.0 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH PETT-2 (PETT130A94)
1JLQ 2001-08-22 3.0 CRYSTAL STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH 739W94
1RTI 1996-04-03 3.0 HIGH RESOLUTION STRUCTURES OF HIV-1 RT FROM FOUR RT-INHIBITOR COMPLEXES
1LW2 2002-10-30 3.0 CRYSTAL STRUCTURE OF T215Y MUTANT HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH 1051U91
4U0D 2014-11-12 3.0 Hexameric HIV-1 CA in complex with Nup153 peptide, P212121 crystal form
1RT3 1999-02-16 3.0 AZT DRUG RESISTANT HIV-1 REVERSE TRANSCRIPTASE COMPLEXED WITH 1051U91
2HNZ 2006-09-05 3.0 Crystal Structure of E138K Mutant HIV-1 Reverse Transcriptase in Complex with PETT-2
1IKV 2001-06-06 3.0 K103N Mutant HIV-1 Reverse Transcriptase in Complex with Efivarenz
2UPJ 1996-10-14 3.0 HIV-1 PROTEASE COMPLEX WITH U100313 ([3-[[3-[CYCLOPROPYL [4-HYDROXY-2OXO-6-[1-(PHENYLMETHYL)PROPYL]-2H-PYRAN-3-YL] METHYL]PHENYL]AMINO]-3-OXO-PROPYL]CARBAMIC ACID TERT-BUTYL ESTER)
4RW7 2015-04-29 3.01 Crystal Structure of HIV-1 Reverse Transcriptase (K103N, Y181C) variant in complex with (E)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (JLJ532), a non-nucleoside inhibitor
2VG6 2007-12-11 3.01 Crystal structures of HIV-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
6CQR 2018-06-06 3.04 Crystal structure of F24 TCR -DR1-RQ13 peptide complex
5HBM 2016-02-24 3.04 Crystal Structure of a Dihydroxycoumarin RNase H Active-Site Inhibitor in Complex with HIV-1 Reverse Transcriptase
3GGV 2009-05-26 3.09 HIV Protease, pseudo-symmetric inhibitors
5TEP 2017-01-11 3.1 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with 7-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)-2-naphthonitrile (JLJ649), a Non-nucleoside Inhibitor
3KJV 2010-03-23 3.1 HIV-1 reverse transcriptase in complex with DNA
1FQX 2001-03-14 3.1 CRYSTAL STRUCTURE OF THE COMPLEX OF HIV-1 PROTEASE WITH A PEPTIDOMIMETIC INHIBITOR
1N5Y 2003-01-28 3.1 HIV-1 Reverse Transcriptase Crosslinked to Post-Translocation AZTMP-Terminated DNA (Complex P)
5FDL 2016-02-17 3.1 Crystal Structure of K103N/Y181C Mutant HIV-1 Reverse Transcriptase (RT) in Complex with IDX899
1T03 2004-05-11 3.1 HIV-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex P)
4LSN 2013-12-25 3.1 Crystal Structure of HIV-1 Reverse Transcriptase in Complex with (E)-3-(3-bromo-5-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (JLJ518), a non-nucleoside inhibitor
1BQM 1999-01-06 3.1 HIV-1 RT/HBY 097
3W39 2013-02-13 3.1 Crystal structure of HLA-B*5201 in complexed with HIV immunodominant epitope (TAFTIPSI)
5HGL 2016-08-10 3.1 Hexameric HIV-1 CA, open conformation
2I5J 2006-12-05 3.15 Crystal structure of HIV-1 reverse transcriptase (RT) in complex with DHBNH, an RNASE H inhibitor
3DRS 2008-10-14 3.15 HIV reverse transcriptase K103N mutant in complex with inhibitor R8D
3KLF 2010-09-22 3.15 Crystal structure of wild-type HIV-1 Reverse Transcriptase crosslinked to a DSDNA with a bound excision product, AZTPPPPA
1HMV 1995-03-31 3.2 THE STRUCTURE OF UNLIGANDED REVERSE TRANSCRIPTASE FROM THE HUMAN IMMUNODEFICIENCY VIRUS TYPE 1
1RTD 1998-12-09 3.2 STRUCTURE OF A CATALYTIC COMPLEX OF HIV-1 REVERSE TRANSCRIPTASE: IMPLICATIONS FOR NUCLEOSIDE ANALOG DRUG RESISTANCE
1UWB 1997-05-15 3.2 TYR 181 CYS HIV-1 RT/8-CL TIBO
3KLE 2010-09-22 3.2 Crystal structure of AZT-resistant HIV-1 Reverse Transcriptase crosslinked to a DSDNA with a bound excision product, AZTPPPPA
2WOM 2010-08-11 3.2 Crystal Structure of UK-453061 bound to HIV-1 Reverse Transcriptase (K103N).
6BSI 2018-01-03 3.25 Structure of HIV-1 RT complexed with an RNA/DNA hybrid containing the polypurine-tract sequence
3JYT 2009-10-06 3.3 K65R mutant HIV-1 reverse transcriptase cross-linked to DS-DNA and complexed with DATP as the incoming nucleotide substrate
5I42 2016-06-01 3.3 Structure of HIV-1 Reverse Transcriptase in complex with a DNA aptamer, AZTTP, and CA(2+) ion
4Q0B 2014-06-18 3.3 Crystal structure of HIV-1 reverse transcriptase in complex with gap-RNA/DNA and Nevirapine
1BQN 1999-01-06 3.3 TYR 188 LEU HIV-1 RT/HBY 097
4B3O 2013-01-16 3.3 Structures of HIV-1 RT and RNA-DNA Complex Reveal a Unique RT Conformation and Substrate Interface
6DTX 2019-07-31 3.33 Wildtype HIV-1 Reverse Transcriptase in complex with JLJ 578
6BJ2 2018-07-25 3.35 TCR589 in complex with HIV(Pol448-456)/HLA-B35
6ECN 2019-08-21 3.4 HIV-1 CA 1/2-hexamer-EE
6EC2 2019-08-21 3.4 Structure of HIV-1 CA 1/3-hexamer
1P7Q 2003-10-14 3.4 Crystal Structure of HLA-A2 Bound to LIR-1, a Host and Viral MHC Receptor
5C42 2015-11-11 3.5 Crystal Structure of HIV-1 Reverse Transcriptase (K101P) Variant in Complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (JLJ555), a non-nucleoside inhibitor
1J5O 2002-06-14 3.5 CRYSTAL STRUCTURE OF MET184ILE MUTANT OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH DOUBLE STRANDED DNA TEMPLATE-PRIMER
3KLG 2010-09-22 3.65 Crystal structure of AZT-resistant HIV-1 Reverse Transcriptase crosslinked to pre-translocation AZTMP-Terminated DNA (COMPLEX N)
1AFV 1997-08-20 3.7 HIV-1 CAPSID PROTEIN (P24) COMPLEX WITH FAB25.3
5L93 2016-07-13 3.9 An atomic model of HIV-1 CA-SP1 reveals structures regulating assembly and maturation
6HAK 2019-04-03 3.95 Crystal structure of HIV-1 reverse transcriptase (RT) in complex with a double stranded RNA represents the RT transcription initiation complex prior to nucleotide incorporation
3DTJ 2008-09-02 4.0 HIV-1 capsid C-terminal domain mutant (E187A)
6B19 2018-04-25 4.5 Architecture of HIV-1 reverse transcriptase initiation complex core
1HVU 1999-01-13 4.75 HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 REVERSE TRANSCRIPTASE COMPLEXED WITH A 33-BASE NUCLEOTIDE RNA PSEUDOKNOT
4B3P 2013-01-16 4.84 Structures of HIV-1 RT and RNA-DNA Complex Reveal a Unique RT Conformation and Substrate Interface
4B3Q 2013-01-16 5.0 Structures of HIV-1 RT and RNA-DNA Complex Reveal a Unique RT Conformation and Substrate Interface
5UPW 2017-03-01 5.0 CryoEM Structure Refinement by Integrating NMR Chemical Shifts with Molecular Dynamics Simulations
5KP9 2016-12-07 5.7 Structure of Nanoparticle Released from Enveloped Protein Nanoparticle
3P0A 2011-01-12 5.95 X-ray structure of pentameric HIV-1 CA
3GV2 2009-06-23 7.0 X-ray Structure of Hexameric HIV-1 CA
5FJB 2016-03-16 9.0 Cyclophilin A Stabilize HIV-1 Capsid through a Novel Non- canonical Binding Site

Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
90.7 Gag-Pol polyprotein Q1A249 POL_SIVEK
90.7 Gag-Pol polyprotein Q1A250 GAG_SIVEK
91.9 Gag-Pol polyprotein Q77373 POL_HV1AN
91.9 Gag-Pol polyprotein Q77372 GAG_HV1AN
91.9 Gag-Pol polyprotein Q9WC63 POL_HV1S9
91.9 Gag-Pol polyprotein Q9WC54 POL_HV1S2
91.9 Gag-Pol polyprotein Q9QBZ9 POL_HV197
91.9 Gag-Pol polyprotein O89290 POL_HV193
91.9 Gag-Pol polyprotein Q9WC62 GAG_HV1S9
91.9 Gag-Pol polyprotein Q9WC53 GAG_HV1S2
91.9 Gag-Pol polyprotein Q9QC00 GAG_HV197
91.9 Gag-Pol polyprotein O89291 GAG_HV193
91.9 Gag-Pol polyprotein Q9IDV9 POL_HV1YB
95.3 Gag-Pol polyprotein P05961 POL_HV1MN
91.9 Gag-Pol polyprotein O41798 POL_HV19N
91.9 Gag-Pol polyprotein Q9IDV8 GAG_HV1YB
91.9 Gag-Pol polyprotein P0C1K7 GAG_HV19N
91.9 Gag-Pol polyprotein O91080 POL_HV1YF
91.9 Gag-Pol polyprotein O91079 GAG_HV1YF
91.9 Gag-Pol polyprotein Q9QBZ1 POL_HV1M2
90.7 Gag-Pol polyprotein O12158 POL_HV192
91.9 Gag-Pol polyprotein Q9QBZ2 GAG_HV1M2
90.7 Gag-Pol polyprotein O12157 GAG_HV192
93.0 Gag-Pol polyprotein P05959 POL_HV1RH
91.9 Gag-Pol polyprotein Q9QBY3 POL_HV196
93.0 Gag-Pol polyprotein P05890 GAG_HV1RH
91.9 Gag-Pol polyprotein Q9QBY4 GAG_HV196
95.3 Gag-Pol polyprotein P12499 POL_HV1Z2
95.3 Gag-Pol polyprotein P12495 GAG_HV1Z2
95.3 Gag-Pol polyprotein P17283 POL_SIVCZ
95.3 Gag-Pol polyprotein P17282 GAG_SIVCZ
93.0 Gag-Pol polyprotein P24740 POL_HV1U4
95.3 Gag-Pol polyprotein P04589 POL_HV1EL
93.0 Gag-Pol polyprotein P24736 GAG_HV1U4
95.3 Gag-Pol polyprotein P04592 GAG_HV1EL
93.0 Gag-Pol polyprotein Q9QBZ5 POL_HV1MP
93.0 Gag-Pol polyprotein Q9QBZ6 GAG_HV1MP
95.3 Gag-Pol polyprotein P04588 POL_HV1MA
95.3 Gag-Pol polyprotein P04594 GAG_HV1MA
96.5 Gag-Pol polyprotein P18802 POL_HV1ND
96.5 Gag-Pol polyprotein P18800 GAG_HV1ND
96.5 Gag-Pol polyprotein P20875 POL_HV1JR
96.5 Gag-Pol polyprotein P20873 GAG_HV1JR
97.7 Gag-Pol polyprotein P05960 POL_HV1C4
97.7 Gag-Pol polyprotein P05887 GAG_HV1C4
97.7 Gag-Pol polyprotein P12498 POL_HV1J3
97.7 Gag-Pol polyprotein P05888 GAG_HV1MN
97.7 Gag-Pol polyprotein P12494 GAG_HV1J3
97.7 Gag-Pol polyprotein P20892 POL_HV1OY
97.7 Gag-Pol polyprotein P03369 POL_HV1A2
97.7 Gag-Pol polyprotein P05889 GAG_HV1W2
97.7 Gag-Pol polyprotein P20889 GAG_HV1OY
97.7 Gag-Pol polyprotein P03349 GAG_HV1A2
97.7 Gag-Pol polyprotein Q73368 POL_HV1B9
97.7 Gag-Pol polyprotein Q73367 GAG_HV1B9
98.8 Gag-Pol polyprotein P35963 POL_HV1Y2
98.8 Gag-Pol polyprotein P0C6F2 POL_HV1LW
98.8 Gag-Pol polyprotein P04585 POL_HV1H2
98.8 Gag-Pol polyprotein P03367 POL_HV1BR
98.8 Gag-Pol polyprotein P04587 POL_HV1B5
98.8 Gag-Pol polyprotein P03366 POL_HV1B1
98.8 Gag-Pol polyprotein P35962 GAG_HV1Y2
98.8 Gag-Pol polyprotein Q70622 GAG_HV1LW
98.8 Gag-Pol polyprotein P04591 GAG_HV1H2
98.8 Gag-Pol polyprotein P03348 GAG_HV1BR
98.8 Gag-Pol polyprotein P04593 GAG_HV1B5
98.8 Gag-Pol polyprotein P03347 GAG_HV1B1
100.0 Gag-Pol polyprotein P12497 POL_HV1N5
100.0 Gag-Pol polyprotein P12493 GAG_HV1N5