The folding of spectrin domains II: phi-value analysis of R16.

Abstract

Studies on the folding of helical proteins have shown a wide range of different mechanisms and highlighted the importance of helical propensity as a factor in determining folding mechanism. Here, we contribute to this interesting field with the protein engineering phi-value analysis of the 16th domain of chicken brain alpha-spectrin, R16. The fortuitous curvature seen in the unfolding arm of the chevron plot allows us to investigate both early and late events in folding. R16 is the first two-state helical protein for which this has been possible. Study holds ProTherm entries: 18107, 18108, 18109, 18110, 18111, 18112, 18113, 18114, 18115, 18116, 18117, 18118, 18119, 18120, 18121, 18122, 18123, 18124, 18125, 18126, 18127, 18128, 18129, 18130, 18131, 18132, 18133, 18134, 18135, 18136, 18137, 18138, 18139, 18140, 18141, 18142, 18143, 18144, 18145, 18146, 18147, 18148, 18149, 18150, 18151, 18152, 18153, 18154, 18155, 18156, 18157, 18158, 18159, 18160, 18161, 18162, 18163, 18164, 18165, 18166, 18167, 18168, 18169, 18170, 18171, 18172, 18173, 18174, 18175 Extra Details: 16th domain. dGH2O is calculated using a mean value of m = 1.9 kcal/mol/M. protein folding; chevron plot; curvature; phi-value; spectrin

Submission Details

ID: PycmqvSn

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:50 p.m.

Version: 1

Publication Details
Scott KA;Randles LG;Clarke J,J. Mol. Biol. (2004) The folding of spectrin domains II: phi-value analysis of R16. PMID:15504412
Additional Information

Study Summary

Number of data points 137
Proteins Spectrin alpha chain, non-erythrocytic 1 ; Spectrin alpha chain, non-erythrocytic 1
Unique complexes 65
Assays/Quantities/Protocols Experimental Assay: dG_H2O ionic:: (PDB: I 22 V; PIR: I 1785 V) ; Experimental Assay: dG_H2O ionic:: ; Derived Quantity: ddG_H2O ionic:: (PDB: I 22 V; PIR: I 1785 V) ; Derived Quantity: ddG_H2O ionic::
Libraries Mutations for sequence AKLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVDHWKELKQLAAARGQRLE

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
100.0 Spectrin alpha chain, non-erythrocytic 1 P07751 SPTN1_CHICK
98.2 Spectrin alpha chain, non-erythrocytic 1 Q13813 SPTN1_HUMAN
97.3 Spectrin alpha chain, non-erythrocytic 1 P16546 SPTN1_MOUSE
97.3 Spectrin alpha chain, non-erythrocytic 1 P16086 SPTN1_RAT