Effect of reductive alkylation on thermal stability of ribonuclease A and chymotrypsinogen A.


Abstract

In order to probe changes in the structural stability induced by the introduction of hydrophobic groups into proteins, the amino groups of ribonuclease A and chymotrypsinogen A were reductively alkylated by reaction with various aliphatic aldehydes, formaldehyde, acetaldehyde, n-butylaldehyde and n-hexylaldehyde, and their thermal stabilities were investigated by differential scanning calorimetry (DSC) at different acidic pH values. Ribonuclease A was thermally unstabilized by reductive alkylation, while chymotrypsinogen A was slightly stabilized, depending on both the size of the introduced alkyl groups and the extent of modification. These observations suggest that the effects induced by alkylation involve not only steric hindrance due to the entering bulky groups but also certain other factors such as the participation of the chemically introduced alkyl groups in hydrophobic interactions. Study holds ProTherm entries: 11525, 11526, 11527, 11528, 11529, 11530, 11531, 11532, 11533, 11534 Extra Details: alkylation; chemical modification; denaturation; DSC; protein; stability

Submission Details

ID: MTE6YsTW4

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:42 p.m.

Version: 1

Publication Details
Fujita Y;Noda Y,Int. J. Pept. Protein Res. (1991) Effect of reductive alkylation on thermal stability of ribonuclease A and chymotrypsinogen A. PMID:1802862
Additional Information

Study Summary

Number of data points 20
Proteins Ribonuclease pancreatic ; Ribonuclease pancreatic ; Chymotrypsinogen A ; Calnexin
Unique complexes 2
Assays/Quantities/Protocols Experimental Assay: dCp buffers:glycine: 0.01 M ; Experimental Assay: dG buffers:glycine: 0.01 M ; Experimental Assay: dCp buffers:glycine: 0.05 M ; Experimental Assay: dG buffers:glycine: 0.05 M ; Experimental Assay: dHcal pH:3.5, buffers:glycine: 0.01 M ; Experimental Assay: Tm pH:3.5, buffers:glycine: 0.01 M ; Experimental Assay: dHcal pH:3.0, buffers:glycine: 0.01 M ; Experimental Assay: Tm pH:3.0, buffers:glycine: 0.01 M ; Experimental Assay: dHcal pH:2.5, buffers:glycine: 0.01 M ; Experimental Assay: Tm pH:2.5, buffers:glycine: 0.01 M ; Experimental Assay: dHcal pH:2.0, buffers:glycine: 0.01 M ; Experimental Assay: Tm pH:2.0, buffers:glycine: 0.01 M ; Experimental Assay: dHcal pH:4.0, buffers:glycine: 0.05 M ; Experimental Assay: Tm pH:4.0, buffers:glycine: 0.05 M ; Experimental Assay: dHcal buffers:glycine: 0.05 M, pH:3.0 ; Experimental Assay: Tm buffers:glycine: 0.05 M, pH:3.0 ; Experimental Assay: dHcal pH:2.5, buffers:glycine: 0.05 M ; Experimental Assay: Tm pH:2.5, buffers:glycine: 0.05 M ; Experimental Assay: dHcal buffers:glycine: 0.05 M, pH:2.0 ; Experimental Assay: Tm buffers:glycine: 0.05 M, pH:2.0
Libraries Mutations for sequence KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV ; Mutations for sequence SKSKPDTSAPTSPKVTYKAPVPSGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSIVNSGNLLNDMTPPVNPSREIEDPEDQKPEDWDERPKIPDPDAVKPDDWNEDAPAKIPDEEATKPDGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIVCGDRRVVDDWANDGWGLKKAADGAAEP

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant PDB Entries

Structure ID Release Date Resolution Structure Title
2AAS 1994-01-31 HIGH-RESOLUTION THREE-DIMENSIONAL STRUCTURE OF RIBONUCLEASE A IN SOLUTION BY NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY
6ETL 2018-02-21 0.85 Atomic resolution structure of RNase A (data collection 2)
6ETK 2018-02-21 0.85 Atomic resolution structure of RNase A (data collection 1)
1DY5 2000-03-28 0.87 Deamidated derivative of bovine pancreatic ribonuclease
6ETM 2018-02-21 0.92 Atomic resolution structure of RNase A (data collection 3)
6ETN 2018-02-21 0.92 Atomic resolution structure of RNase A (data collection 4)
6ETP 2018-02-21 1.02 Atomic resolution structure of RNase A (data collection 6)
6ETO 2018-02-21 1.02 Atomic resolution structure of RNase A (data collection 5)
1KF3 2001-12-19 1.05 Atomic Resolution Structure of RNase A at pH 5.9
2E3W 2007-10-30 1.05 X-ray structure of native RNase A
6ETQ 2018-02-21 1.08 Atomic resolution structure of RNase A (data collection 7)
1KF2 2001-12-19 1.1 Atomic Resolution Structure of RNase A at pH 5.2
1KF4 2001-12-19 1.1 Atomic Resolution Structure of RNase A at pH 6.3
2P45 2008-03-11 1.1 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.1A resolution: SE5B-ORTHO-1 crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
2NUI 2007-10-30 1.1 X-ray Structure of synthetic [D83A]RNase A
6F60 2018-04-25 1.14 The x-ray structure of bovine pancreatic ribonuclease in complex with a five-coordinate platinum(II) compound containing a sugar ligand
1KF7 2001-12-19 1.15 Atomic Resolution Structure of RNase A at pH 8.0
1KF8 2001-12-19 1.15 Atomic resolution structure of RNase A at pH 8.8
1KF5 2001-12-19 1.15 Atomic Resolution Structure of RNase A at pH 7.1
5OGH 2018-08-01 1.16 Structure of RNase A at high resolution (1.16 A) in complex with 3'-CMP and sulphate ions
6ETR 2018-02-21 1.17 Atomic resolution structure of RNase A (data collection 8)
1O0H 2003-12-09 1.2 Ribonuclease A in complex with 5'-ADP
1O0O 2003-12-09 1.2 Ribonuclease A in complex with adenosine-2',5'-diphosphate
4O36 2014-05-07 1.22 Semisynthetic RNase S1-15-H7/11-Q10
1RUV 1997-04-01 1.25 RIBONUCLEASE A-URIDINE VANADATE COMPLEX: HIGH RESOLUTION RESOLUTION X-RAY STRUCTURE (1.3 A)
7RSA 1988-10-09 1.26 STRUCTURE OF PHOSPHATE-FREE RIBONUCLEASE A REFINED AT 1.26 ANGSTROMS
3QL1 2012-02-29 1.29 Crystal Structure of Ribonuclease A Variant A4C/D83E/V118C
3I6H 2010-07-07 1.3 Ribonuclease A by LB nanotemplate method before high X-Ray dose on ESRF ID14-2 beamline
3I67 2010-07-07 1.3 Ribonuclease A by LB nanotemplate method after high X-Ray dose on ESRF ID14-2 beamline
3I6F 2010-07-07 1.3 Ribonuclease A by Classical hanging drop method before high X-Ray dose on ESRF ID14-2 beamline
3I6J 2010-07-07 1.3 Ribonuclease A by Classical hanging drop method after high X-Ray dose on ESRF ID14-2 beamline
2QCA 2007-07-03 1.33 A New Crystal Form of Bovine Pancreatic RNase A in Complex with 2'-Deoxyguanosine-5'-monophosphate
1YPH 2006-02-14 1.34 High resolution structure of bovine alpha-chymotrypsin
4K7L 2014-05-14 1.38 Crystal structure of RNase S variant (K7C/Q11C)
2P49 2007-08-28 1.38 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.4A resolution: native mono_1 crystal form
3DXG 2009-06-16 1.39 Ribonuclease A- uridine 5' phosphate complex
1RPG 1994-12-20 1.4 STRUCTURES OF RNASE A COMPLEXED WITH 3'-CMP AND D(CPA): ACTIVE SITE CONFORMATION AND CONSERVED WATER MOLECULES
1GG6 2000-09-20 1.4 CRYSTAL STRUCTURE OF GAMMA CHYMOTRYPSIN WITH N-ACETYL-PHENYLALANINE TRIFLUOROMETHYL KETONE BOUND AT THE ACTIVE SITE
3DIB 2008-07-15 1.4 Crystal structure of bovine pancreatic ribonuclease A variant (I106A)
1FS3 2002-02-13 1.4 CRYSTAL STRUCTURE OF WILD-TYPE BOVINE PANCREATIC RIBONUCLEASE A
2BLZ 2005-09-07 1.4 RNAse after a high dose X-ray 'burn'
3DXH 2009-06-16 1.4 Ribonuclease A uridine 5' diphosphate complex
1EID 2002-02-13 1.4 CRYSTAL STRUCTURE OF F120G MUTANT OF BOVINE PANCREATIC RIBONUCLEASE A
1EIC 2002-02-13 1.4 CRYSTAL STRUCTURE OF F120A MUTANT OF BOVINE PANCREATIC RIBONUCLEASE A
1EIE 2002-02-13 1.4 CRYSTAL STRUCTURE OF F120W MUTANT OF BOVINE PANCREATIC RIBONUCLEASE A
4O37 2014-05-07 1.4 seminsynthetic RNase S1-15-3Pl-7/11
2BLP 2005-09-07 1.4 RNase before unattenuated X-RAY burn
1YMN 2006-01-31 1.45 The study of reductive unfolding pathways of RNase A (Y92L mutant)
3RN3 1991-10-31 1.45 SEGMENTED ANISOTROPIC REFINEMENT OF BOVINE RIBONUCLEASE A BY THE APPLICATION OF THE RIGID-BODY TLS MODEL
4WYZ 2015-11-18 1.45 The crystal structure of the A109G mutant of RNase A in complex with 3'UMP
3OQY 2010-10-20 1.49 Semi-synthetic ribonuclease S: para-cyano-phenylalanine at position 8
3QL2 2012-02-29 1.49 Crystal Structure of Ribonuclease A Variant A4C/D83E/V118C
1RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
2G8Q 2006-08-15 1.5 The crystal structure of RNase A from monoclinic crystals at 100 K
5RAT 1993-07-15 1.5 Effects of temperature on protein structure and dynamics: X-ray crystallographic studies of the protein ribonuclease-A at nine different temperatures from 98 TO 320 K
1RND 1994-01-31 1.5 NEWLY OBSERVED BINDING MODE IN PANCREATIC RIBONUCLEASE
1YMR 2006-01-31 1.5 The study of reductive unfolding pathways of RNase A (Y92A mutant)
1O0M 2003-12-09 1.5 Ribonuclease A in complex with uridine-2'-phosphate
4WYP 2015-11-18 1.5 The crystal structure of the A109G mutant of RNase A in complex with 5'AMP
1IZP 2003-11-25 1.5 F46L mutant of bovine pancreatic ribonuclease A
1Z6S 2005-08-16 1.5 Ribonuclease A- AMP complex
9RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
1IZR 2003-11-25 1.5 F46A mutant of bovine pancreatic ribonuclease A
6RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
3MZQ 2011-05-25 1.5 RNase crystals grown by the hanging drop method
1O0F 2003-12-09 1.5 RNASE A in complex with 3',5'-ADP
1O0N 2003-12-09 1.5 Ribonuclease A in complex with uridine-3'-phosphate
3MZR 2011-05-25 1.5 RNase crystals grown in loops/micromounts
7RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
1RHB 1995-02-27 1.5 WATER DEPENDENT DOMAIN MOTION AND FLEXIBILITY IN RIBONUCLEASE A AND THE INVARIANT FEATURES IN ITS HYDRATION SHELL. AN X-RAY STUDY OF TWO LOW HUMIDITY CRYSTAL FORMS OF THE ENZYME
1YMW 2006-01-31 1.5 The study of reductive unfolding pathways of RNase A (Y92G mutant)
8RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
1GGD 2000-09-20 1.5 CRYSTAL STRUCTURE OF GAMMA CHYMOTRYPSIN WITH N-ACETYL-LEUCIL-PHENYLALANINE ALDEHYDE BOUND AT THE ACTIVE SITE
2RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
1RNC 1994-01-31 1.5 NEWLY OBSERVED BINDING MODE IN PANCREATIC RIBONUCLEASE
4RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
3RAT 1993-07-15 1.5 EFFECTS OF TEMPERATURE ON PROTEIN STRUCTURE AND DYNAMICS: X-RAY CRYSTALLOGRAPHIC STUDIES OF THE PROTEIN RIBONUCLEASE-A AT NINE DIFFERENT TEMPERATURES FROM 98 TO 320 K
2P8O 2007-05-08 1.5 Crystal Structure of a Benzohydroxamic Acid/Vanadate complex bound to chymotrypsin A
5D6U 2016-04-06 1.52 X-ray crystal structure of ribonuclease A determined for the real space D/H contrast method
4OKF 2015-03-04 1.54 RNase S in complex with an artificial peptide
1Z6D 2005-08-16 1.54 Ribonuclease A- IMP complex
3LXO 2010-04-28 1.55 The crystal structure of ribonuclease A in complex with thymidine-3'-monophosphate
3D6O 2009-02-10 1.58 The RNase A- 5'-Deoxy-5'-N-(ethyl isonipecotatyl)uridine complex
4AO1 2012-07-18 1.58 High resolution crystal structure of bovine pancreatic ribonuclease crystallized using ionic liquid
1RNV 1994-01-31 1.6 REFINEMENT OF THE CRYSTAL STRUCTURE OF RIBONUCLEASE S. COMPARISON WITH AND BETWEEN THE VARIOUS RIBONUCLEASE A STRUCTURES
3JW1 2009-10-06 1.6 Crystal Structure of Bovine Pancreatic Ribonuclease Complexed with Uridine-5'-monophosphate at 1.60 A Resolution
1ROB 1994-01-31 1.6 STRUCTURE OF THE CRYSTALLINE COMPLEX OF CYTIDYLIC ACID (2'-CMP) WITH RIBONUCLEASE AT 1.6 ANGSTROMS RESOLUTION
3DI8 2008-07-15 1.6 Crystal structure of bovine pancreatic ribonuclease A variant (V57A)
3D6Q 2009-02-10 1.6 The RNase A- 5'-Deoxy-5'-N-piperidinouridine complex
1A5P 1998-05-27 1.6 C[40,95]A VARIANT OF BOVINE PANCREATIC RIBONUCLEASE A
3DH6 2008-07-15 1.6 Crystal structure of bovine pancreatic ribonuclease A variant (V47A)
3DI7 2008-07-15 1.6 Crystal structure of bovine pancreatic ribonuclease A variant (V54A)
2OP2 2007-10-30 1.6 Crystal structure of RNase double-mutant V43C R85C with extra disulphide bond
1AB9 1997-08-20 1.6 CRYSTAL STRUCTURE OF BOVINE GAMMA-CHYMOTRYPSIN
3GCT 1991-10-15 1.6 STRUCTURE OF GAMMA-*CHYMOTRYPSIN IN THE RANGE $P*H 2.0 TO $P*H 10.5 SUGGESTS THAT GAMMA-CHYMOTRYPSIN IS A COVALENT ACYL-ENZYME ADDUCT AT LOW $P*H
1GCT 1991-10-15 1.6 IS GAMMA-CHYMOTRYPSIN A TETRAPEPTIDE ACYL-ENZYME ADDUCT OF GAMMA-CHYMOTRYPSIN?
8GCH 1992-04-15 1.6 GAMMA-CHYMOTRYPSIN IS A COMPLEX OF ALPHA-CHYMOTRYPSIN WITH ITS OWN AUTOLYSIS PRODUCTS
1BEL 1996-10-14 1.6 HYDROLASE PHOSPHORIC DIESTER, RNA
4RSD 1998-07-15 1.6 STRUCTURE OF THE D121A VARIANT OF RIBONUCLEASE A
3RSD 1998-07-15 1.6 STRUCTURE OF THE D121N VARIANT OF RIBONUCLEASE A
3D7B 2009-02-10 1.6 The Ribonuclease A- 5'-Deoxy-5'-N-pyrrolidinouridine complex
3D6P 2009-02-10 1.6 RNase A- 5'-Deoxy-5'-N-morpholinouridine complex
3DIC 2008-07-15 1.6 Crystal structure of bovine pancreatic ribonuclease A variant (V108A)
3DH5 2008-07-15 1.6 Crystal structure of bovine pancreatic ribonuclease A (wild-type)
1W4O 2005-02-02 1.6 Binding of Nonnatural 3'-Nucleotides to Ribonuclease A
2RNS 1994-01-31 1.6 REFINEMENT OF THE CRYSTAL STRUCTURE OF RIBONUCLEASE S. COMPARISON WITH AND BETWEEN THE VARIOUS RIBONUCLEASE A STRUCTURES
1RNU 1994-01-31 1.6 REFINEMENT OF THE CRYSTAL STRUCTURE OF RIBONUCLEASE S. COMPARISON WITH AND BETWEEN THE VARIOUS RIBONUCLEASE A STRUCTURES
3FL3 2009-03-24 1.6 X-ray structure of the ligand free non covalent swapped form of the A19P/Q28L/K31C/S32C mutant of bovine pancreatic ribonuclease
4L55 2014-01-29 1.65 X-ray structure of the adduct between bovine pancreatic ribonuclease and AziRu
3EUX 2009-06-23 1.65 Crystal Structure of Crosslinked Ribonuclease A
2P43 2008-03-11 1.65 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.65A resolution: SE3-mono-1 crystal form with three se-met sites (M34, M51, M83) in vhh scaffold
5CHA 1985-04-01 1.67 THE REFINEMENT AND THE STRUCTURE OF THE DIMER OF ALPHA-*CHYMOTRYPSIN AT 1.67-*ANGSTROMS RESOLUTION
3VGC 1997-11-12 1.67 GAMMA-CHYMOTRYPSIN L-NAPHTHYL-1-ACETAMIDO BORONIC ACID ACID INHIBITOR COMPLEX
3MWQ 2011-02-09 1.68 Crystal structure of ribonuclease A tandem enzymes and their interaction with the cytosolic ribonuclease inhibitor
4CHA 1985-04-01 1.68 STRUCTURE OF ALPHA-*CHYMOTRYPSIN REFINED AT 1.68 ANGSTROMS RESOLUTION
1W4Q 2005-02-02 1.68 Binding of Nonnatural 3'-Nucleotides to Ribonuclease A
3EV5 2009-06-23 1.68 Crystal Structure of Ribonuclease A in 1M Trimethylamine N-Oxide
3EV3 2009-06-23 1.68 Crystal Structure of Ribonuclease A in 70% t-Butanol
5E5F 2015-12-09 1.68 X-ray structure of the complex between RNase A and compound 4-PF6 ([(PPh3)Au(mi-pbi)Pt(Me)(DMSO)][PF6]), the heterobimetallic derivative obtained in the reaction between the organometallic compound [Pt(pbi)(Me)(DMSO)], pbi=2-(2'-pyridil)benzimidazole (compound 3) and the gold(I) compound [Au(Ph3P)][PF6]
3RU4 2012-08-29 1.68 Crystal structure of the Bowman-Birk serine protease inhibitor BTCI in complex with trypsin and chymotrypsin
1RBW 1995-10-15 1.69 RIBONUCLEASE A (E.C.3.1.27.5) WITH GUANIDINIUM
4J60 2014-01-22 1.69 Crystal structure of Ribonuclease A soaked in 25% Cyclopentanol: One of twelve in MSCS set
1W4P 2005-02-02 1.69 Binding of Nonnatural 3'-Nucleotides to Ribonuclease A
4J61 2014-01-22 1.69 Crystal structure of Ribonuclease A soaked in 40% Cyclopentanone: One of twelve in MSCS set
1RBX 1995-10-15 1.69 RIBONUCLEASE A (E.C.3.1.27.5) CONTROL
1AFL 1998-03-18 1.7 RIBONUCLEASE A IN COMPLEX WITH 5'-DIPHOSPHOADENOSINE 2'-PHOSPHATE AT 1.7 ANGSTROM RESOLUTION
4G8V 2012-11-21 1.7 Crystal structure of Ribonuclease A in complex with 5a
1AFK 1998-03-18 1.7 CRYSTAL STRUCTURE OF RIBONUCLEASE A IN COMPLEX WITH 5'-DIPHOSPHOADENOSINE-3'-PHOSPHATE
2W5K 2009-02-17 1.7 RNASE A-NADPH COMPLEX
1F0V 2001-02-21 1.7 Crystal structure of an Rnase A dimer displaying a new type of 3D domain swapping
1QHC 1999-08-31 1.7 CRYSTAL STRUCTURE OF RIBONUCLEASE A IN COMPLEX WITH 5'-PHOSPHO-2'-DEOXYURIDINE-3'-PYROPHOSPHATE ADENOSINE-3'-PHOSPHATE
2W5G 2009-02-17 1.7 RNASE A-5'-ATP COMPLEX
1C9V 2001-06-27 1.7 H12A VARIANT OF RIBONUCLEASE A
3RSP 1998-04-22 1.7 STRUCTURE OF THE P93G VARIANT OF RIBONUCLEASE A
1RAS 1993-10-31 1.7 CRYSTAL STRUCTURE OF A FLUORESCENT DERIVATIVE OF RNASE A
2W5L 2009-02-17 1.7 RNASE A-NADP COMPLEX
2G8R 2006-08-15 1.7 The crystal structure of the RNase A- 3-N-piperidine-4-carboxyl-3-deoxy-ara-uridine complex
3A1R 2009-09-01 1.7 Neutron crystal structure analysis of bovine pancreatic ribonuclease A
1RBH 1993-10-31 1.7 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
1T8O 2005-03-08 1.7 CRYSTAL STRUCTURE OF THE P1 TRP BPTI MUTANT- BOVINE CHYMOTRYPSIN COMPLEX
1RBD 1993-10-31 1.7 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
2XOI 2011-01-19 1.72 Functional and Structural Analyses of N-Acylsulfonamide-Linked Dinucleoside Inhibitors of Ribonuclease A
2XOG 2011-01-19 1.72 Functional and Structural Analyses of N-Acylsulfonamide-Linked Dinucleoside Inhibitors of Ribonuclease A
3D8Y 2009-02-10 1.72 RNase A- 5'-Deoxy-5'-N-piperidinothymidine complex
1RBE 1993-10-31 1.75 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
3QSK 2011-08-10 1.75 5 Histidine Variant of the anti-RNase A VHH in Complex with RNAse A
4POU 2014-09-24 1.75 VHH-metal in Complex with RNase A
1T8N 2005-03-08 1.75 CRYSTAL STRUCTURE OF THE P1 THR BPTI MUTANT- BOVINE CHYMOTRYPSIN COMPLEX
1P2M 2004-04-20 1.75 Structural consequences of accommodation of four non-cognate amino-acid residues in the S1 pocket of bovine trypsin and chymotrypsin
1T8L 2005-03-08 1.75 CRYSTAL STRUCTURE OF THE P1 MET BPTI MUTANT- BOVINE CHYMOTRYPSIN COMPLEX
3EV6 2009-06-23 1.76 Crystal Structure of Ribonuclease A in 50% R,S,R-Bisfuranol
3EV0 2009-06-23 1.76 Crystal Structure of Ribonuclease A in 70% Dimethyl Sulfoxide
4J68 2014-01-22 1.78 Crystal structure of Ribonuclease A soaked in 40% Isopropanol: One of twelve in MSCS set
4J64 2014-01-22 1.78 Crystal structure of Ribonuclease A soaked in 40% Dioxane: One of twelve in MSCS set
5OLD 2018-08-29 1.78 X-ray structure of the adduct formed upon reaction of ribonuclease A with a tetranuclear Pt-thiosemicarbazone compound
1JVU 2002-06-05 1.78 CRYSTAL STRUCTURE OF RIBONUCLEASE A (COMPLEXED FORM)
5JLG 2016-08-03 1.79 The X-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and compound I, a piano-stool organometallic Ru(II) arene compound containing an O,S-chelating ligand
4ZZ4 2016-04-06 1.8 Neutron crystal structure of ribonuclease A determined by the real space D/H contrast method
1RBF 1993-10-31 1.8 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
4K7M 2013-11-27 1.8 Crystal structure of RNase S variant (K7C/Q11C) with bound mercury ions
1Z3L 2005-03-29 1.8 X-Ray Crystal Structure of a Mutant Ribonuclease S (F8Anb)
2P42 2008-03-11 1.8 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.8A resolution: SE3-mono-2 crystal form with three se-met sites (M34, M51, M83) in vhh scaffold
2GCT 1991-10-15 1.8 STRUCTURE OF GAMMA-CHYMOTRYPSIN IN THE RANGE PH 2.0 TO PH 10.5 SUGGESTS THAT GAMMA-CHYMOTRYPSIN IS A COVALENT ACYL-ENZYME ADDUCT AT LOW PH
4J5Z 2014-01-22 1.8 Crystal structure of Ribonuclease A in aqueous solution: One of twelve in MSCS set
1C8W 2002-05-01 1.8 THR45GLY VARIANT OF RIBONUCLEASE A
1SRN 1990-10-15 1.8 THE REFINED CRYSTAL STRUCTURE OF A FULLY ACTIVE SEMISYNTHETIC RIBONUCLEASE AT 1.8 ANGSTROMS RESOLUTION
1JN4 2003-06-03 1.8 The Crystal Structure of Ribonuclease A in complex with 2'-deoxyuridine 3'-pyrophosphate (P'-5') adenosine
1C9X 2001-06-27 1.8 H119A VARIANT OF RIBONUCLEASE A
2P44 2008-03-11 1.8 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.8A resolution: SE5A-mono-1 crystal form with five se-met sites (M34, M51, F68M, M83, L86M) in vhh scaffold
7GCH 1990-10-15 1.8 STRUCTURE OF CHYMOTRYPSIN-*TRIFLUOROMETHYL KETONE INHIBITOR COMPLEXES. COMPARISON OF SLOWLY AND RAPIDLY EQUILIBRATING INHIBITORS
1P2N 2004-04-20 1.8 Structural consequences of accommodation of four non-cognate amino-acid residues in the S1 pocket of bovine trypsin and chymotrypsin
2W5M 2009-02-17 1.8 RNASE A-PYROPHOSPHATE ION COMPLEX
8RSA 1991-04-15 1.8 CRYSTAL STRUCTURE OF TWO COVALENT NUCLEOSIDE DERIVATIVES OF RIBONUCLEASE A
1RHA 1995-02-27 1.8 WATER DEPENDENT DOMAIN MOTION AND FLEXIBILITY IN RIBONUCLEASE A AND THE INVARIANT FEATURES IN ITS HYDRATION SHELL. AN X-RAY STUDY OF TWO LOW HUMIDITY CRYSTAL FORMS OF THE ENZYME
4WYN 2015-11-18 1.8 The crystal structure of the A109G mutant of RNase A
2APQ 2005-09-13 1.8 Crystal Structure of an Active Site Mutant of Bovine Pancreatic Ribonuclease A (H119A-RNase A) with a 10-Glutamine expansion in the C-terminal hinge-loop.
9RSA 1991-04-15 1.8 CRYSTAL STRUCTURE OF TWO COVALENT NUCLEOSIDE DERIVATIVES OF RIBONUCLEASE A
1K2I 2001-12-05 1.8 Crystal Structure of Gamma-Chymotrypsin in Complex with 7-Hydroxycoumarin
1P2Q 2004-04-20 1.8 Structural consequences of accommodation of four non-cognate amino-acid residues in the S1 pocket of bovine trypsin and chymotrypsin
1RBI 1993-10-31 1.8 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
6CHA 1987-04-16 1.8 STRUCTURE OF A TETRAHEDRAL TRANSITION STATE COMPLEX OF ALPHA-*CHYMOTRYPSIN AT 1.8-*ANGSTROMS RESOLUTION
4G8Y 2012-11-21 1.8 Crystal structure of Ribonuclease A in complex with 5b
2GMT 1994-11-01 1.8 THREE-DIMENSIONAL STRUCTURE OF CHYMOTRYPSIN INACTIVATED WITH (2S) N-ACETYL-L-ALANYL-L-PHENYLALANYL-CHLOROETHYL KETONE: IMPLICATIONS FOR THE MECHANISM OF INACTIVATION OF SERINE PROTEASES BY CHLOROKETONES
2CGA 1987-04-16 1.8 BOVINE CHYMOTRYPSINOGEN A. X-RAY CRYSTAL STRUCTURE ANALYSIS AND REFINEMENT OF A NEW CRYSTAL FORM AT 1.8 ANGSTROMS RESOLUTION
1CHO 1988-07-16 1.8 CRYSTAL AND MOLECULAR STRUCTURES OF THE COMPLEX OF ALPHA-*CHYMOTRYPSIN WITH ITS INHIBITOR TURKEY OVOMUCOID THIRD DOMAIN AT 1.8 ANGSTROMS RESOLUTION
1IZQ 2003-11-25 1.8 F46V mutant of bovine pancreatic ribonuclease A
1AFQ 1997-09-17 1.8 CRYSTAL STRUCTURE OF BOVINE GAMMA-CHYMOTRYPSIN COMPLEXED WITH A SYNTHETIC INHIBITOR
1XPS 1998-05-27 1.8 BOVINE RIBONUCLEASE A (PHOSPHATE-FREE) (93 % HUMIDITY)
1RNN 1996-04-03 1.8 RIBONUCLEASE A COMPLEX WITH CYTIDYLIC ACID (5'CMP) CRYSTALLIZED FROM 8M SODIUM FORMATE
1T8M 2005-03-08 1.8 CRYSTAL STRUCTURE OF THE P1 HIS BPTI MUTANT- BOVINE CHYMOTRYPSIN COMPLEX
5D97 2016-04-06 1.8 Neutron crystal structure of H2O-solvent ribonuclease A
2VGC 1997-11-12 1.8 GAMMA-CHYMOTRYPSIN D-PARA-CHLORO-1-ACETAMIDO BORONIC ACID INHIBITOR COMPLEX
1RNW 1997-04-01 1.8 RECOMBINANT RIBONUCLEASE A CRYSTALLIZED FROM 80% AMMONIUM SULPHATE
1RBG 1993-10-31 1.8 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
5OBE 2017-07-26 1.82 X-ray structure of the adduct formed upon reaction of ribonuclease A with the compound fac-[RuII(CO)3Cl2(N3-MBI), MBI=methyl-benzimidazole
3EUZ 2009-06-23 1.84 Crystal Structure of Ribonuclease A in 50% Dimethylformamide
2G4W 2007-02-20 1.84 anomalous substructure of ribonuclease A (C2)
5JMG 2016-07-27 1.85 X-ray structure of the complex between bovine pancreatic ribonuclease and pentachlorocarbonyliridate(III) (4 days of soaking)
2RLN 1994-11-01 1.85 THERMODYNAMIC AND STRUCTURAL CONSEQUENCES OF CHANGING A SULPHUR ATOM TO A METHYLENE GROUP IN THE M13NLE MUTATION IN RIBONUCLEASE S
1T7C 2005-03-08 1.85 CRYSTAL STRUCTURE OF THE P1 GLU BPTI MUTANT- BOVINE CHYMOTRYPSIN COMPLEX
3MWR 2011-02-09 1.85 Crystal structure of ribonuclease A tandem enzymes and their interaction with the cytosolic ribonuclease inhibitor
4OT4 2014-07-09 1.85 X-ray Structure of the Adduct formed between cisplatin and Ribonuclease A
4J67 2014-01-22 1.86 Crystal structure of Ribonuclease A soaked in 50% 1,6-Hexanediol: One of twelve in MSCS set
6DI8 2019-01-23 1.86 Crystal structure of bovine alpha-chymotrypsin in space group P65
4OOH 2015-02-25 1.89 Structure of RIBONUCLEASE A at 40C
4J69 2014-01-22 1.89 Crystal structure of Ribonuclease A soaked in 50% S,R,S-bisfuranol: One of twelve in MSCS set
1RNX 1996-11-08 1.9 RIBONUCLEASE A CRYSTALLIZED FROM 3M SODIUM CHLORIDE, 30% AMMONIUM SULFATE
4GCH 1990-10-15 1.9 STRUCTURE AND ACTIVITY OF TWO PHOTOREVERSIBLE CINNAMATES BOUND TO CHYMOTRYPSIN
3FL1 2009-03-24 1.9 X-ray structure of the non covalent swapped form of the A19P/Q28L/K31C/S32C mutant of bovine pancreatic ribonuclease in complex with 2'-DEOXYCYTIDINE-2'-DEOXYGUANOSINE-3',5'-MONOPHOSPHATE
1WBU 2005-01-27 1.9 Fragment based lead discovery using crystallography
1RAR 1993-10-31 1.9 CRYSTAL STRUCTURE OF A FLUORESCENT DERIVATIVE OF RNASE A
2P4A 2007-08-28 1.9 X-ray structure of a camelid affinity matured single-domain vhh antibody fragment in complex with RNASE A
1LSQ 1997-01-11 1.9 RIBONUCLEASE A WITH ASN 67 REPLACED BY A BETA-ASPARTYL RESIDUE
1VGC 1997-11-12 1.9 GAMMA-CHYMOTRYPSIN L-PARA-CHLORO-1-ACETAMIDO BORONIC ACID INHIBITOR COMPLEX
1GCD 1994-06-22 1.9 REFINED CRYSTAL STRUCTURE OF 'AGED' AND 'NON-AGED' ORGANOPHOSPHORYL CONJUGATES OF GAMMA-CHYMOTRYPSIN
4G90 2012-11-21 1.9 Crystal structure of Ribonuclease A in complex with 5e
1C0B 1999-10-14 1.9 BOVINE PANCREATIC RIBONUCLEASE A DESICCATED FOR 2.5 DAYS
2GCH 1980-07-09 1.9 REFINED CRYSTAL STRUCTURE OF GAMMA-CHYMOTRYPSIN AT 1.9 ANGSTROMS RESOLUTION
1XPT 1998-05-27 1.9 BOVINE RIBONUCLEASE A (PHOSPHATE-FREE)
1RNZ 1997-04-01 1.9 RIBONUCLEASE A CRYSTALLIZED FROM 2.5M SODIUM CHLORIDE, 3.3M SODIUM FORMATE
1RNO 1996-04-03 1.9 RIBONUCLEASE A CRYSTALLIZED FROM 80% AMMONIUM SULPHATE
1RCA 1995-09-15 1.9 STRUCTURE OF THE CRYSTALLINE COMPLEX OF DEOXYCYTIDYLYL-3',5'-GUANOSINE (3',5'-DCPDG) CO-CRYSTALISED WITH RIBONUCLEASE AT 1.9 ANGSTROMS RESOLUTION. RETROBINDING IN PANCREATIC RNASEA IS INDEPENDENT OF MODE OF INHIBITOR INTROMISSION
3GCH 1990-10-15 1.9 CHEMISTRY OF CAGED ENZYMES. BINDING OF PHOTOREVERSIBLE CINNAMATES TO CHYMOTRYPSIN
3EV4 2009-06-23 1.93 Crystal Structure of Ribonuclease A in 50% Trifluoroethanol
3FL0 2009-03-24 1.94 X-ray structure of the non covalent swapped form of the Q28L/K31C/S32C mutant of bovine pancreatic ribonuclease in complex with 2'-DEOXYCYTIDINE-2'-DEOXYGUANOSINE-3',5'-MONOPHOSPHATE
3EUY 2009-06-23 1.95 Crystal Structure of Ribonuclease A in 50% Dioxane
2G4X 2007-02-20 1.95 Anomalous substructure od ribonuclease A (P3221)
4RTE 2015-03-25 1.95 The X-ray structure of bovine pancreatic ribonuclease incubated in the presence of an excess of cisplatin (1:10 ratio)
4J65 2014-01-22 1.96 Crystal structure of Ribonuclease A soaked in 40% Dimethylformamide: One of twelve in MSCS set
3D8Z 2009-02-10 1.98 RNase A- 5'-Deoxy-5'-N-pyrrolidinothymidine complex
5OBD 2017-07-26 1.98 X-ray structure of the adduct formed upon reaction of ribonuclease A with the compound fac-[RuII(CO)3Cl2(N3-MIM), MIM=methyl-imidazole
5E5E 2015-12-09 1.98 X-ray structure of the adduct formed in the reaction between RNase A and a neutral organometallic derivative [Pt(pbi)(Me)(DMSO)], pbi=2-(2'-pyridil)benzimidazole (compound 3)
3FKZ 2009-03-24 1.99 X-ray structure of the non covalent swapped form of the S16G/T17N/A19P/A20S/K31C/S32C mutant of bovine pancreatic ribonuclease
1N8O 2002-12-18 2.0 Crystal structure of a complex between bovine chymotrypsin and ecotin
5RSA 1985-07-17 2.0 COMPARISON OF TWO INDEPENDENTLY REFINED MODELS OF RIBONUCLEASE-A
1RNY 1996-11-08 2.0 RIBONUCLEASE A CRYSTALLIZED FROM 3M CESIUM CHLORIDE, 30% AMMONIUM SULFATE
1RBC 1993-10-31 2.0 CRYSTALLOGRAPHIC STRUCTURES OF RIBONUCLEASE S VARIANTS WITH NONPOLAR SUBSTITUTION AT POSITION 13: PACKING AND CAVITIES
1ACB 1993-10-31 2.0 CRYSTAL AND MOLECULAR STRUCTURE OF THE BOVINE ALPHA-CHYMOTRYPSIN-EGLIN C COMPLEX AT 2.0 ANGSTROMS RESOLUTION
1B6V 1999-06-15 2.0 CRYSTAL STRUCTURE OF A HYBRID BETWEEN RIBONUCLEASE A AND BOVINE SEMINAL RIBONUCLEASE
1RNM 1996-04-03 2.0 RIBONUCLEASE A COMPLEX WITH CYTIDYLIC ACID (5'CMP) CRYSTALLIZED FROM 80% AMMONIUM SULPHATE
1C0C 1999-10-14 2.0 BOVINE PANCREATIC RIBONUCLEASE A DESICCATED FOR 4.0 DAYS
1GHB 1994-06-22 2.0 A SECOND ACTIVE SITE IN CHYMOTRYPSIN? THE X-RAY CRYSTAL STRUCTURE OF N-ACETYL-D-TRYPTOPHAN BOUND TO GAMMA-CHYMOTRYPSIN
1Z3P 2005-03-29 2.0 X-Ray crystal structure of a mutant Ribonuclease S (M13Nva)
3DI9 2008-07-15 2.0 Crystal structure of bovine pancreatic ribonuclease A variant (I81A)
1AQP 1998-05-27 2.0 RIBONUCLEASE A COPPER COMPLEX
3RSK 1998-07-15 2.0 STRUCTURE OF THE K7A/R10A/K66A VARIANT OF RIBONUCLEASE A
2CHA 1977-01-18 2.0 THE STRUCTURE OF CRYSTALLINE ALPHA-CHYMOTRYPSIN, $V.THE ATOMIC STRUCTURE OF TOSYL-ALPHA-CHYMOTRYPSIN AT 2 ANGSTROMS RESOLUTION
3SRN 1994-12-20 2.0 STRUCTURAL CHANGES THAT ACCOMPANY THE REDUCED CATALYTIC EFFICIENCY OF TWO SEMISYNTHETIC RIBONUCLEASE ANALOGS
6RSA 1986-05-07 2.0 NUCLEAR MAGNETIC RESONANCE AND NEUTRON DIFFRACTION STUDIES OF THE COMPLEX OF RIBONUCLEASE*A WITH URIDINE VANADATE, A TRANSITION-STATE ANALOGUE
4QH3 2014-07-30 2.0 X-ray structure of the adduct formed between bovine pancreatic ribonuclease and trans-dimethylamine methylamine dichlorido platinum(II)
3EV1 2009-06-23 2.0 Crystal Structure of Ribonuclease A in 70% Hexanediol
4SRN 1994-12-20 2.0 STRUCTURAL CHANGES THAT ACCOMPANY THE REDUCED CATALYTIC EFFICIENCY OF TWO SEMISYNTHETIC RIBONUCLEASE ANALOGS
1U1B 2005-06-28 2.0 Structure of bovine pancreatic Ribonuclease A in complex with 3'-phosphothymidine (3'-5')-pyrophosphate adenosine 3'-phosphate
1KH8 2003-06-17 2.0 Structure of a cis-proline (P114) to glycine variant of Ribonuclease A
3T62 2012-08-01 2.0 Crystal structure of recombinant Kunitz Type serine protease Inhibitor-1 from the Caribbean Sea anemone Stichodactyla helianthus in complex with bovine chymotrypsin
1EOW 2000-11-17 2.0 CRYSTAL STRUCTURE OF RIBONUCLEASE A COMPLEXED WITH URIDYLYL(2',5')GUANOSINE (NON-PRODUCTIVE BINDING)
1RNQ 1996-04-03 2.0 RIBONUCLEASE A CRYSTALLIZED FROM 8M SODIUM FORMATE
1EOS 2000-08-30 2.0 CRYSTAL STRUCTURE OF RIBONUCLEASE A COMPLEXED WITH URIDYLYL(2',5')GUANOSINE (PRODUCTIVE BINDING)
1SSA 1994-09-30 2.0 A STRUCTURAL INVESTIGATION OF CATALYTICALLY MODIFIED F12OL AND F12OY SEMISYNTHETIC RIBONUCLEASES
1RSM 1986-01-21 2.0 THE 2-ANGSTROMS RESOLUTION STRUCTURE OF A THERMOSTABLE RIBONUCLEASE A CHEMICALLY CROSS-LINKED BETWEEN LYSINE RESIDUES 7 AND 41
1P2O 2004-04-20 2.0 Structural consequences of accommodation of four non-cognate amino-acid residues in the S1 pocket of bovine trypsin and chymotrypsin
1Z3M 2005-03-29 2.0 Crystal structure of mutant Ribonuclease S (F8Nva)
1AFU 1998-03-18 2.0 STRUCTURE OF RIBONUCLEASE A AT 2.0 ANGSTROMS FROM MONOCLINIC CRYSTALS
1SSB 1994-09-30 2.0 A STRUCTURAL INVESTIGATION OF CATALYTICALLY MODIFIED F12OL AND F12OY SEMISYNTHETIC RIBONUCLEASES
1SSC 1995-01-26 2.0 THE 1.6 ANGSTROMS STRUCTURE OF A SEMISYNTHETIC RIBONUCLEASE CRYSTALLIZED FROM AQUEOUS ETHANOL. COMPARISON WITH CRYSTALS FROM SALT SOLUTIONS AND WITH RNASE A FROM AQUEOUS ALCOHOL SOLUTIONS
3EV2 2009-06-23 2.02 Crystal Structure of Ribonuclease A in 70% Isopropanol
6QE9 2019-02-27 2.03 The X-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and complex I, a pentacoordinate Pt(II) compound containing 2,9-dimethyl-1,10-phenanthroline, dimethylfumarate, methyl and iodine as ligands
4J6A 2014-01-22 2.04 Crystal structure of Ribonuclease A soaked in 40% 2,2,2-Trifluoroethanol: One of twelve in MSCS set
4J62 2014-01-22 2.04 Crystal structure of Ribonuclease A soaked in 40% Cyclohexanol: One of twelve in MSCS set
4J66 2014-01-22 2.04 Crystal structure of Ribonuclease A soaked in 25% Dimethyl sulfoxide: One of twelve in MSCS set
4J63 2014-01-22 2.04 Crystal structure of Ribonuclease A soaked in 40% Cyclohexanone: One of twelve in MSCS set
1JVT 2002-06-05 2.05 CRYSTAL STRUCTURE OF RIBONUCLEASE A (LIGAND-FREE FORM)
5NA9 2017-08-16 2.07 The X-ray structure of bovine pancreatic ribonuclease incubated in the presence of an excess of carboplatin (1:10 ratio)
5OBC 2017-07-26 2.07 X-ray structure of the adduct formed upon reaction of ribonuclease A with the compound fac-[RuII(CO)3Cl2(N3-IM), IM=imidazole
4S0Q 2015-11-18 2.09 The X-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and carboplatin
1GL1 2001-11-28 2.1 structure of the complex between bovine alpha-chymotrypsin and PMP-C, an inhibitor from the insect Locusta migratoria
6GCH 1990-10-15 2.1 STRUCTURE OF CHYMOTRYPSIN-*TRIFLUOROMETHYL KETONE INHIBITOR COMPLEXES. COMPARISON OF SLOWLY AND RAPIDLY EQUILIBRATING INHIBITORS
1GV7 2002-08-22 2.1 ARH-I, an angiogenin/RNase A chimera
1RBN 1994-12-20 2.1 THE STRUCTURE OF RIBONUCLEASE A DERIVATIVE II AT 2.1 ANGSTROMS RESOLUTION
5J4S 2017-04-12 2.1 alpha-chymotrypsin from bovine pancreas in complex with a modified Bowman-Birk inhibitor from soybean
1GMH 1994-09-30 2.1 REFINED CRYSTAL STRUCTURE OF 'AGED' AND 'NON-AGED' ORGANOPHOSPHORYL CONJUGATES OF GAMMA-CHYMOTRYPSIN
4VGC 1997-11-12 2.1 GAMMA-CHYMOTRYPSIN D-NAPHTHYL-1-ACETAMIDO BORONIC ACID INHIBITOR COMPLEX
5ET4 2016-11-30 2.1 Structure of RNase A-K7H/R10H in complex with 3'-CMP
4RSK 1998-12-09 2.1 STRUCTURE OF THE K7A/R10A/K66A VARIANT OF RIBONUCLEASE A COMPLEXED WITH 3'-UMP
3MX8 2011-02-09 2.1 Crystal structure of ribonuclease A tandem enzymes and their interaction with the cytosolic ribonuclease inhibitor
1A2W 1998-04-29 2.1 CRYSTAL STRUCTURE OF A 3D DOMAIN-SWAPPED DIMER OF BOVINE PANCREATIC RIBONUCLEASE A
3RH1 2012-02-15 2.1 X-ray Structure of a cis-proline (P114) to alanine variant of Ribonuclease A
1CA0 1997-07-23 2.1 BOVINE CHYMOTRYPSIN COMPLEXED TO APPI
1J80 2001-06-06 2.1 Osmolyte Stabilization of RNase
1DLK 2000-05-03 2.14 CRYSTAL STRUCTURE ANALYSIS OF DELTA-CHYMOTRYPSIN BOUND TO A PEPTIDYL CHLOROMETHYL KETONE INHIBITOR
5NJ7 2018-05-16 2.15 The X-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and arsenoplatin-1
4YGW 2015-07-01 2.18 RNase S in complex with stabilized S peptide
3RID 2012-02-15 2.18 X-ray structure of the C-terminal swapped dimer of P114A variant of Ribonuclease A
1RPF 1994-12-20 2.2 THE STRUCTURES OF RNASE COMPLEXED WITH 3'-CMP AND D(CPA): ACTIVE SITE CONFORMATION AND CONSERVED WATER MOLECULES
1GMC 1993-10-31 2.2 THE X-RAY CRYSTAL STRUCTURE OF THE TETRAHEDRAL INTERMEDIATE OF GAMMA-CHYMOTRYPSIN IN HEXANE
1JVV 2002-06-05 2.2 CRYSTAL STRUCTURE OF RIBONUCLEASE A (RETRO-SOAKED FORM)
1GMD 1993-10-31 2.2 X-ray crystal structure of gamma-chymotrypsin in hexane
4Q2K 2014-07-23 2.2 Bovine alpha chymotrypsin bound to a cyclic peptide inhibitor, 5b
1J81 2001-06-06 2.2 Osmolyte Stabilization of RNase
1OXG 2004-05-18 2.2 Crystal structure of a complex formed between organic solvent treated bovine alpha-chymotrypsin and its autocatalytically produced highly potent 14-residue peptide at 2.2 resolution
1RPH 1994-12-20 2.2 STRUCTURES OF RNASE A COMPLEXED WITH 3'-CMP AND D(CPA): ACTIVE SITE CONFORMATION AND CONSERVED WATER MOLECULES
1GHA 1994-06-22 2.2 A SECOND ACTIVE SITE IN CHYMOTRYPSIN? THE X-RAY CRYSTAL STRUCTURE OF N-ACETYL-D-TRYPTOPHAN BOUND TO GAMMA-CHYMOTRYPSIN
1JS0 2002-03-13 2.2 Crystal Structure of 3D Domain-swapped RNase A Minor Trimer
4PEQ 2014-06-25 2.21 Structure of bovine ribonuclease inhibitor complexed with bovine ribonuclease I
4MXF 2013-12-25 2.25 X-ray structure of the adduct between bovine pancreatic ribonuclease and Auoxo6, a dinuclear gold(III) complex with -dioxo bridges linking the two metal centers
1D5E 1999-10-20 2.25 The role of phenylalanine 8 in the stabilization of the S protein-S peptide interaction: Packing and cavities
1J7Z 2001-06-06 2.25 Osmolyte Stabilization of Ribonuclease
1D5H 1999-10-20 2.25 Rnase s(f8a). mutant ribonucleasE S.
1D5D 1999-10-20 2.25 The role of phenylalanine 8 in the stabilization of the s protein-s peptide interaction: packing and cavities
1FEV 2000-08-09 2.25 CRYSTAL STRUCTURE OF THE ALA4AIB MUTATION IN RNASE S
4S18 2015-11-25 2.27 The X-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and oxaliplatin
5JML 2016-07-27 2.29 X-ray structure of the complex between bovine pancreatic ribonuclease and penthachlorocarbonyliridate(III) (2 months of soaking)
1HJA 1998-01-14 2.3 LYS 18 VARIANT OF TURKEY OVOMUCOID INHIBITOR THIRD DOMAIN COMPLEXED WITH ALPHA-CHYMOTRYPSIN
3OR0 2010-10-20 2.3 Semi-synthetic ribonuclease S: cyanylated homocysteine at position 13
1CJR 1999-05-07 2.3 X-RAY CRYSTALLOGRAPHIC STUDIES OF DENATURATION IN RIBONUCLEASE S
2OQF 2008-02-12 2.3 Structure of a synthetic, non-natural analogue of RNase A: [N71K(Ade), D83A]RNase A
1J82 2001-06-06 2.3 Osmolyte Stabilization of RNase
2P48 2008-03-11 2.3 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 2.3A resolution: SE5B-tetra crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
1A5Q 1998-05-27 2.3 P93A VARIANT OF BOVINE PANCREATIC RIBONUCLEASE A
5J4Q 2017-04-12 2.3 alpha-chymotrypsin from bovine pancreas in complex with Bowman-Birk inhibitor from soybean
1CGI 1993-10-31 2.3 THREE-DIMENSIONAL STRUCTURE OF THE COMPLEXES BETWEEN BOVINE CHYMOTRYPSINOGEN*A AND TWO RECOMBINANT VARIANTS OF HUMAN PANCREATIC SECRETORY TRYPSIN INHIBITOR (KAZAL-TYPE)
1CGJ 1993-10-31 2.3 THREE-DIMENSIONAL STRUCTURE OF THE COMPLEXES BETWEEN BOVINE CHYMOTRYPSINOGEN*A AND TWO RECOMBINANT VARIANTS OF HUMAN PANCREATIC SECRETORY TRYPSIN INHIBITOR (KAZAL-TYPE)
6QMN 2019-05-08 2.31 Crystal structure of a Ribonuclease A-Onconase chimera
1RCN 1994-09-30 2.32 CRYSTAL STRUCTURE OF THE RIBONUCLEASE A D(APTPAPAPG) COMPLEX : DIRECT EVIDENCE FOR EXTENDED SUBSTRATE RECOGNITION
3I7W 2009-08-04 2.35 High pressure structure of wild-type RNase A (0.67 GPa)
3I7Y 2009-08-04 2.4 High pressure structure of I106A variant of RNase A (0.48 GPa)
2W5I 2009-02-17 2.4 RNASE A-AP3A COMPLEX
1RTB 1993-10-31 2.5 CRYSTAL STRUCTURE DISPOSITION OF THYMIDYLIC ACID TETRAMER IN COMPLEX WITH RIBONUCLEASE A
1RBB 1988-07-16 2.5 THE CRYSTAL STRUCTURE OF RIBONUCLEASE B AT 2.5-ANGSTROMS RESOLUTION
1DFJ 1997-01-11 2.5 RIBONUCLEASE INHIBITOR COMPLEXED WITH RIBONUCLEASE A
3BG4 2008-07-29 2.5 The crystal structure of guamerin in complex with chymotrypsin and the development of an elastase-specific inhibitor
2P46 2008-03-11 2.5 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 2.5A resolution: se5b-ortho-2 crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
1RTA 1993-10-31 2.5 CRYSTAL STRUCTURE DISPOSITION OF THYMIDYLIC ACID TETRAMER IN COMPLEX WITH RIBONUCLEASE A
2P47 2008-03-11 2.5 Complex of a camelid single-domain vhh antibody fragment with RNASE A at 2.5A resolution: SE5B-TRI crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
3OQZ 2010-10-20 2.5 Semi-synthetic ribonuclease S: meta-cyano-phenylalanine at position 8
1CHG 1976-11-22 2.5 CHYMOTRYPSINOGEN,2.5 ANGSTROMS CRYSTAL STRUCTURE, COMPARISON WITH ALPHA-CHYMOTRYPSIN,AND IMPLICATIONS FOR ZYMOGEN ACTIVATION
1UN5 2004-02-06 2.6 ARH-II, AN ANGIOGENIN/RNASE A CHIMERA
3I7X 2009-08-04 2.6 High pressure structure of I106A RNase A variant (0.35 GPa)
1CBW 1997-07-23 2.6 BOVINE CHYMOTRYPSIN COMPLEXED TO BPTI
6GOK 2018-07-25 2.65 X-ray structure of the adduct formed upon reaction of bovine pancreatic ribonuclease with a Pd(II) complex bearing N,N-pyridylbenzimidazole derivative with an alkylated sulphonate side chain
1RBJ 1995-12-07 2.7 RIBONUCLEASE B COMPLEX WITH D(TETRA-(DEOXY-ADENYLATE))
5GCH 1990-10-15 2.7 CHEMISTRY OF CAGED ENZYMES /II$. PHOTOACTIVATION OF INHIBITED CHYMOTRYPSIN
2E33 2007-03-20 2.7 Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
2Y6T 2011-04-20 2.74 Molecular Recognition of Chymotrypsin by the Serine Protease Inhibitor Ecotin from Yersinia pestis
1BZQ 1998-11-11 2.8 COMPLEX OF A DROMEDARY SINGLE-DOMAIN VHH ANTIBODY FRAGMENT WITH RNASE A
1MTN 1996-08-17 2.8 BOVINE ALPHA-CHYMOTRYPSIN:BPTI CRYSTALLIZATION
1JHN 2001-10-10 2.9 Crystal Structure of the Lumenal Domain of Calnexin
1CJQ 1999-05-07 3.0 X-RAY CRYSTALLOGRAPHIC STUDIES OF THE DENATURATION OF THE DENATURATION OF RIBONUCLEASE S.
1GL0 2001-11-28 3.0 structure of the complex between bovine alpha-chymotrypsin and PMP-D2v, an inhibitor from the insect Locusta migratoria
1EX3 2000-05-17 3.0 CRYSTAL STRUCTURE OF BOVINE CHYMOTRYPSINOGEN A (TETRAGONAL)

Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
96.0 Ribonuclease pancreatic Q29606 RNAS1_ORYLE
90.3 Ribonuclease pancreatic P00662 RNAS1_GIRCA
92.7 Ribonuclease pancreatic P00668 RNAS1_ANTAM
95.2 Ribonuclease pancreatic P00660 RNAS1_CONTA
93.5 Ribonuclease pancreatic P07848 RNAS1_EUDTH
96.0 Ribonuclease pancreatic P07847 RNAS1_AEPME
95.2 Ribonuclease pancreatic P00657 RNAS1_BUBBU
96.8 Ribonuclease pancreatic P67927 RNAS1_SHEEP
96.8 Ribonuclease pancreatic P67926 RNAS1_CAPHI
100.0 Ribonuclease pancreatic P61823 RNAS1_BOVIN
100.0 Ribonuclease pancreatic P61824 RNAS1_BISBI
100.0 Chymotrypsinogen A P00766 CTRA_BOVIN
96.4 Calnexin P35565 CALX_RAT
97.6 Calnexin P35564 CALX_MOUSE
96.1 Calnexin P27824 CALX_HUMAN
96.4 Calnexin Q5R440 CALX_PONAB
99.8 Calnexin P24643 CALX_CANLF