Bovine seminal ribonuclease (BS-RNase) is a dimeric protein with two identical subunits linked by two disulfide bridges, each subunit showing 80% of sequence identity with pancreatic RNase A. BS-RNase exists in two different quaternary conformations in solution: the MxM form, in which each subunit exchanges its alpha-helical N-terminal segment with its partner, and the M=M form with no exchange. By differential scanning microcalorimetry (DSC), the denaturation of the two dimeric forms of BS-RNase was found to be more complex than a simple two-state process. Monomeric derivatives of the dimeric protein follow instead a simple two-state mechanism, but are distinctly less stable than RNase A. The three-state N if I if D denaturation process of the two quaternary isoforms was interpreted by identifying in the dimers a central highly structured core, enclosing the covalently bonded subunit interface, which unfolds only after the periphery (mainly the N-terminal peptide) unfolds. Circular dichroism spectra of the two forms in the far-ultraviolet region show large differences between the secondary structure of the isoforms and that of the native BS-RNase mixture at equilibrium. This has been attributed to the presence in the equilibrium mixture of intermediate forms with displaced and disordered N-terminal alpha-helical segments. Study holds ProTherm entries: 8307, 8308 Extra Details: disulfide bridges; dimeric forms; secondary structure;,alpha-helical segments
ID: Kb2Wb8FM4
Submitter: Connie Wang
Submission Date: April 24, 2018, 8:35 p.m.
Version: 1
Number of data points | 4 |
Proteins | Seminal ribonuclease ; Seminal ribonuclease |
Unique complexes | 1 |
Assays/Quantities/Protocols | Experimental Assay: Tm pH:8.4 ; Experimental Assay: dHvH pH:8.4 ; Experimental Assay: Tm pH:5.0 ; Experimental Assay: dHvH pH:5.0 |
Libraries | Mutations for sequence KESAAAKFERQHMDSGNSPSSSSNYCNLMMCCRKMTQGKCKPVNTFVHESLADVKAVCSQKKVTCKNGQTNCYQSKSTMRITDCRETGSSKYPNCAYKTTQVEKHIIVACGGKPSVPVHFDASV |
Colors: | D | E | R | H | K | S | T | N | Q | A | V | I | L | M | F | Y | W | C | G | P |
---|
Percent Identity | Matching Chains | Protein | Accession | Entry Name |
---|---|---|---|---|
100.0 | Seminal ribonuclease | P00669 | RNS_BOVIN |