Spin-label electron paramagnetic resonance and differential scanning calorimetry studies of the interaction between mitochondrial cytochrome c oxidase and adenosine triphosphate synthase complex.


Abstract

The interaction between cytochrome c oxidase complex and adenosine triphosphate synthase (F1F0) complex in the purified, dispersed state and embedded in phospholipid vesicles was studied by differential scanning calorimetry and by spin-label electron paramagnetic resonance. The detergent-dispersed cytochrome oxidase and F1F0 complexes undergo endothermic thermodenaturation. However, when these complexes are embedded in phospholipid vesicles, they undergo exothermic thermodenaturation. The energy released is believed to result from the collapse of a strained interaction between unsaturated fatty acyl groups of phospholipids and an exposed area of the complex formed by the removal of interacting proteins. The exothermic enthalpy change of thermodenaturation of a protein-phospholipid exothermic enthalpy change of thermodenaturation of a protein-phospholipid vesicle containing both cytochrome oxidase complex and F1F0 was smaller than that of a mixture of protein-phospholipid vesicles formed from each individual electron transfer complex. This suggests specific interaction between cytochrome oxidase complex and F1F0 in the membrane. Further evidence for interaction between these two complexes is provided by saturation transfer EPR studies in which the rotational correlation time of spin-labeled cytochrome oxidase increases significantly when the complex is mixed with F1F0 prior to being embedded in phospholipid vesicles. From these results, it is concluded that at least a part of cytochrome oxidase and a part of F1F0 form a supermacromolecular complex in the inner mitochondrial membrane. No such supermacromolecular complex is detected between F1F0 and ubiquinol--cytochrome c reductase. Study holds ProTherm entries: 4034 Extra Details: exothermic thermodenaturation; fatty acyl groups; membrane;,electron transfer complex; supermacromolecular complex

Submission Details

ID: FhTGKvwE4

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:24 p.m.

Version: 1

Publication Details
Qiu ZH;Yu L;Yu CA,Biochemistry (1992) Spin-label electron paramagnetic resonance and differential scanning calorimetry studies of the interaction between mitochondrial cytochrome c oxidase and adenosine triphosphate synthase complex. PMID:1313290
Additional Information

Study Summary

Number of data points 1
Proteins Cytochrome c oxidase subunit 1 ; Cytochrome c oxidase subunit 1
Unique complexes 1
Assays/Quantities/Protocols Experimental Assay: Tm
Libraries Mutations for sequence A:MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK/B:MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML/C:MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAGAWYWHFVDVVWLFLYVSIYWWGS/D:AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK/E:SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV/F:ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQLAH/G:ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK/H:AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI/I:STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK/J:FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK/K:IHQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWREQ/L:SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK/M:ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA/N:MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK/O:MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML/P:MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAGAWYWHFVDVVWLFLYVSIYWWGS/Q:AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK/R:SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV/S:ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQLAH/T:ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK/U:AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI/V:STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK/W:FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK/X:IHQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWREQ/Y:SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK/Z:ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
200.0 A,N Cytochrome c oxidase subunit 1 Q6EMS9 COX1_BOSIN
200.0 A,N Cytochrome c oxidase subunit 1 P00396 COX1_BOVIN
198.8 A,N Cytochrome c oxidase subunit 1 O78749 COX1_SHEEP
198.0 A,N Cytochrome c oxidase subunit 1 Q36347 COX1_CAPHI
198.4 A,N Cytochrome c oxidase subunit 1 Q5Y4Q8 COX1_BOSMU
195.4 A,N Cytochrome c oxidase subunit 1 Q9ZZY9 COX1_HIPAM
195.0 A,N Cytochrome c oxidase subunit 1 O03198 COX1_CERSI
194.2 A,N Cytochrome c oxidase subunit 1 P48659 COX1_HORSE
193.8 A,N Cytochrome c oxidase subunit 1 P92477 COX1_EQUAS
193.8 A,N Cytochrome c oxidase subunit 1 O79876 COX1_PIG
194.2 A,N Cytochrome c oxidase subunit 1 P48888 COX1_FELCA
194.6 A,N Cytochrome c oxidase subunit 1 Q9ZZ64 COX1_CANLF
194.6 A,N Cytochrome c oxidase subunit 1 Q1HKA1 COX1_CANLU
193.4 A,N Cytochrome c oxidase subunit 1 Q00527 COX1_PHOVI
192.6 A,N Cytochrome c oxidase subunit 1 Q8LX30 COX1_LEMCA
192.6 A,N Cytochrome c oxidase subunit 1 P38595 COX1_HALGR
191.4 A,N Cytochrome c oxidase subunit 1 Q599A1 COX1_BALBO
191.0 A,N Cytochrome c oxidase subunit 1 P24983 COX1_BALPH
190.6 A,N Cytochrome c oxidase subunit 1 P41293 COX1_BALMU
190.6 A,N Cytochrome c oxidase subunit 1 Q8W9N4 COX1_DUGDU
191.8 A,N Cytochrome c oxidase subunit 1 O79429 COX1_RABIT
190.2 A,N Cytochrome c oxidase subunit 1 O21327 COX1_DASNO
188.4 A,N Cytochrome c oxidase subunit 1 P00397 COX1_MOUSE
189.4 A,N Cytochrome c oxidase subunit 1 P41310 COX1_DIDVI
189.8 A,N Cytochrome c oxidase subunit 1 P92661 COX1_MACRO
187.6 A,N Cytochrome c oxidase subunit 1 P05503 COX1_RAT
189.0 A,N Cytochrome c oxidase subunit 1 Q6EGI3 COX1_ORTHI
189.0 A,N Cytochrome c oxidase subunit 1 Q6EGH9 COX1_GEOBE
189.0 A,N Cytochrome c oxidase subunit 1 Q6EGH8 COX1_GEOTE
189.0 A,N Cytochrome c oxidase subunit 1 Q6EGI0 COX1_PAPBU
188.6 A,N Cytochrome c oxidase subunit 1 Q6EGJ0 COX1_CRAZI
188.2 A,N Cytochrome c oxidase subunit 1 Q6EGJ1 COX1_CRANE
187.8 A,N Cytochrome c oxidase subunit 1 Q6EGI4 COX1_ORTUN
187.8 A,N Cytochrome c oxidase subunit 1 Q6EGI2 COX1_ORTGR
187.0 A,N Cytochrome c oxidase subunit 1 Q6EGI5 COX1_ORTCH
187.8 A,N Cytochrome c oxidase subunit 1 Q6EGH7 COX1_ZYGTR
184.8 A,N Cytochrome c oxidase subunit 1 Q36452 COX1_ORNAN
186.0 A,N Cytochrome c oxidase subunit 1 Q96062 COX1_RHIUN
184.0 A,N Cytochrome c oxidase subunit 1 Q7GEN7 COX1_HYLLA
184.0 A,N Cytochrome c oxidase subunit 1 Q34800 COX1_SYMSY
183.2 A,N Cytochrome c oxidase subunit 1 P00395 COX1_HUMAN
182.8 A,N Cytochrome c oxidase subunit 1 Q9T9W1 COX1_PANTR
182.8 A,N Cytochrome c oxidase subunit 1 Q9T9X0 COX1_PANPA
180.2 A,N Cytochrome c oxidase subunit 1 O99041 COX1_COLPO
181.2 A,N Cytochrome c oxidase subunit 1 Q4JQI5 COX1_TETNG
181.2 A,N Cytochrome c oxidase subunit 1 Q9TA27 COX1_LOXAF
181.2 A,N Cytochrome c oxidase subunit 1 P92692 COX1_PONAB
180.4 A,N Cytochrome c oxidase subunit 1 Q38PS0 COX1_MAMPR
189.2 A,N Cytochrome c oxidase subunit 1 O03546 COX1_RHEAM
189.2 A,N Cytochrome c oxidase subunit 1 O03521 COX1_CASBE
189.2 A,N Cytochrome c oxidase subunit 1 O03524 COX1_DRONO
188.0 A,N Cytochrome c oxidase subunit 1 O03539 COX1_NOTPE
186.2 A,N Cytochrome c oxidase subunit 1 O03515 COX1_APTAU
187.4 A,N Cytochrome c oxidase subunit 1 O03554 COX1_TINMA
197.0 A,N Cytochrome c oxidase subunit 1 Q33375 COX1_CANSI
182.0 A,N Cytochrome c oxidase subunit 1 P29643 COX1_AMICA
183.6 A,N Cytochrome c oxidase subunit 1 P29649 COX1_PANBU
181.6 A,N Cytochrome c oxidase subunit 1 P29651 COX1_POLSX
186.4 A,N Cytochrome c oxidase subunit 1 P29647 COX1_LEPOC
186.2 A,N Cytochrome c oxidase subunit 1 P29648 COX1_MEGAT
186.2 A,N Cytochrome c oxidase subunit 1 P29652 COX1_POMNI
187.4 A,N Cytochrome c oxidase subunit 1 P29650 COX1_POLSP
187.2 A,N Cytochrome c oxidase subunit 1 P29654 COX1_SCAPL
186.0 A,N Cytochrome c oxidase subunit 1 P29644 COX1_ATRSP
187.0 A,N Cytochrome c oxidase subunit 1 P29646 COX1_GOMVA
183.4 A,N Cytochrome c oxidase subunit 1 P29653 COX1_SALTR
192.0 A,N Cytochrome c oxidase subunit 1 P50656 COX1_ANAPL
199.2 C,P Cytochrome c oxidase subunit 1 P00415 COX3_BOVIN
198.4 C,P Cytochrome c oxidase subunit 1 Q576B8 COX3_BOSIN
195.4 C,P Cytochrome c oxidase subunit 1 Q5Y4Q4 COX3_BOSMU
193.8 C,P Cytochrome c oxidase subunit 1 O47701 COX3_ANTMR
193.8 C,P Cytochrome c oxidase subunit 1 O47695 COX3_OUROU
193.2 C,P Cytochrome c oxidase subunit 1 O47692 COX3_PELCP
193.8 C,P Cytochrome c oxidase subunit 1 O47702 COX3_ANTCE
193.2 C,P Cytochrome c oxidase subunit 1 O47687 COX3_TRASR
193.2 C,P Cytochrome c oxidase subunit 1 O47708 COX3_GAZCU
193.2 C,P Cytochrome c oxidase subunit 1 O47694 COX3_DAMLU
191.6 C,P Cytochrome c oxidase subunit 1 O47685 COX3_TRAIM
191.6 C,P Cytochrome c oxidase subunit 1 O47693 COX3_CEPNA
193.2 C,P Cytochrome c oxidase subunit 1 P68531 COX3_GAZBE
193.2 C,P Cytochrome c oxidase subunit 1 P68532 COX3_GAZGA
193.2 C,P Cytochrome c oxidase subunit 1 O47706 COX3_EUDTH
192.4 C,P Cytochrome c oxidase subunit 1 P68299 COX3_GAZDO
192.4 C,P Cytochrome c oxidase subunit 1 P68300 COX3_GAZSP
192.4 C,P Cytochrome c oxidase subunit 1 O47700 COX3_LITWA
192.4 C,P Cytochrome c oxidase subunit 1 O47690 COX3_SYNCA
192.4 C,P Cytochrome c oxidase subunit 1 O47689 COX3_TRAST
193.2 C,P Cytochrome c oxidase subunit 1 O48316 COX3_GAZSU
192.4 C,P Cytochrome c oxidase subunit 1 O47709 COX3_GAZLE
192.4 C,P Cytochrome c oxidase subunit 1 P68088 COX3_NANGR
192.4 C,P Cytochrome c oxidase subunit 1 P68089 COX3_NANSO
191.6 C,P Cytochrome c oxidase subunit 1 O47688 COX3_TRASP
191.6 C,P Cytochrome c oxidase subunit 1 O47691 COX3_AEPME
190.8 C,P Cytochrome c oxidase subunit 1 O47698 COX3_NEOMO
192.4 C,P Cytochrome c oxidase subunit 1 O47705 COX3_EUDRU
191.6 C,P Cytochrome c oxidase subunit 1 O48374 COX3_NANDA
191.6 C,P Cytochrome c oxidase subunit 1 O47699 COX3_MADGU
191.6 C,P Cytochrome c oxidase subunit 1 O21619 COX3_SHEEP
190.8 C,P Cytochrome c oxidase subunit 1 O47686 COX3_TRAOR
191.6 C,P Cytochrome c oxidase subunit 1 O47710 COX3_GAZSA
192.4 C,P Cytochrome c oxidase subunit 1 O47696 COX3_RAPCA
191.6 C,P Cytochrome c oxidase subunit 1 O47697 COX3_RAPME
187.8 C,P Cytochrome c oxidase subunit 1 Q96065 COX3_RHIUN
186.2 C,P Cytochrome c oxidase subunit 1 P41295 COX3_BALMU
187.8 C,P Cytochrome c oxidase subunit 1 Q35916 COX3_PIG
185.4 C,P Cytochrome c oxidase subunit 1 P24989 COX3_BALPH
185.4 C,P Cytochrome c oxidase subunit 1 O03201 COX3_CERSI
185.4 C,P Cytochrome c oxidase subunit 1 P38597 COX3_HALGR
184.6 C,P Cytochrome c oxidase subunit 1 Q00529 COX3_PHOVI
186.2 C,P Cytochrome c oxidase subunit 1 Q9ZZY5 COX3_HIPAM
184.0 C,P Cytochrome c oxidase subunit 1 O21331 COX3_DASNO
184.6 C,P Cytochrome c oxidase subunit 1 P92481 COX3_EQUAS
184.6 C,P Cytochrome c oxidase subunit 1 P48661 COX3_HORSE
183.2 C,P Cytochrome c oxidase subunit 1 P48892 COX3_FELCA
182.4 C,P Cytochrome c oxidase subunit 1 Q1HK97 COX3_CANLU
182.4 C,P Cytochrome c oxidase subunit 1 Q9ZZ61 COX3_CANLF
200.0 B,O Cytochrome c oxidase subunit 1 P68553 COX2_BOSIN
200.0 B,O Cytochrome c oxidase subunit 1 P68554 COX2_BOSMU
200.0 B,O Cytochrome c oxidase subunit 1 P68530 COX2_BOVIN
199.2 B,O Cytochrome c oxidase subunit 1 P68296 COX2_BISBO
199.2 B,O Cytochrome c oxidase subunit 1 P68295 COX2_BOSGA
199.2 B,O Cytochrome c oxidase subunit 1 P68294 COX2_BOSJA
197.4 B,O Cytochrome c oxidase subunit 1 P50680 COX2_GAZSP
197.4 B,O Cytochrome c oxidase subunit 1 P50675 COX2_SYNCA
197.4 B,O Cytochrome c oxidase subunit 1 Q37419 COX2_BOSTR
197.4 B,O Cytochrome c oxidase subunit 1 Q37440 COX2_RUSUN
197.4 B,O Cytochrome c oxidase subunit 1 P50678 COX2_BUBDE
195.6 B,O Cytochrome c oxidase subunit 1 Q37430 COX2_CAPHI
195.6 B,O Cytochrome c oxidase subunit 1 Q37685 COX2_TRAIM
197.4 B,O Cytochrome c oxidase subunit 1 Q37416 COX2_BISBI
194.8 B,O Cytochrome c oxidase subunit 1 O78750 COX2_SHEEP
194.6 B,O Cytochrome c oxidase subunit 1 Q37369 COX2_ANTAM
193.0 B,O Cytochrome c oxidase subunit 1 P50679 COX2_DAMPP
193.8 B,O Cytochrome c oxidase subunit 1 P50667 COX2_PIG
193.8 B,O Cytochrome c oxidase subunit 1 O03851 COX2_CERSI
193.8 B,O Cytochrome c oxidase subunit 1 P48890 COX2_FELCA
192.0 B,O Cytochrome c oxidase subunit 1 Q96190 COX2_RHIUN
192.0 B,O Cytochrome c oxidase subunit 1 P41294 COX2_BALMU
193.0 B,O Cytochrome c oxidase subunit 1 P92478 COX2_EQUAS
191.2 B,O Cytochrome c oxidase subunit 1 Q599A0 COX2_BALBO
192.0 B,O Cytochrome c oxidase subunit 1 P48660 COX2_HORSE
190.4 B,O Cytochrome c oxidase subunit 1 P24986 COX2_BALPH
189.4 B,O Cytochrome c oxidase subunit 1 Q37643 COX2_RHIDA
190.4 B,O Cytochrome c oxidase subunit 1 Q3L6W7 COX2_AILFU
189.4 B,O Cytochrome c oxidase subunit 1 P38596 COX2_HALGR
189.4 B,O Cytochrome c oxidase subunit 1 Q00528 COX2_PHOVI
189.4 B,O Cytochrome c oxidase subunit 1 O47667 COX2_CANAD
187.6 B,O Cytochrome c oxidase subunit 1 P98031 COX2_CANSI
188.6 B,O Cytochrome c oxidase subunit 1 P67781 COX2_CANLA
188.6 B,O Cytochrome c oxidase subunit 1 P67780 COX2_CANLF
188.6 B,O Cytochrome c oxidase subunit 1 P67782 COX2_CANLU
188.6 B,O Cytochrome c oxidase subunit 1 O47671 COX2_CANME
188.6 B,O Cytochrome c oxidase subunit 1 O47668 COX2_CUOAL
187.6 B,O Cytochrome c oxidase subunit 1 Q7J6G4 COX2_ATEMI
187.6 B,O Cytochrome c oxidase subunit 1 O48267 COX2_LYCGR
187.6 B,O Cytochrome c oxidase subunit 1 Q7J6G2 COX2_LYCVE
187.6 B,O Cytochrome c oxidase subunit 1 O48276 COX2_UROCI
186.8 B,O Cytochrome c oxidase subunit 1 O47672 COX2_CERTH
186.8 B,O Cytochrome c oxidase subunit 1 Q2Y0B9 COX2_AILME
185.0 B,O Cytochrome c oxidase subunit 1 Q37649 COX2_ROULE
186.8 B,O Cytochrome c oxidase subunit 1 O47680 COX2_VULMA
186.8 B,O Cytochrome c oxidase subunit 1 O47681 COX2_VULVU
186.8 B,O Cytochrome c oxidase subunit 1 O47673 COX2_VULZE
187.6 B,O Cytochrome c oxidase subunit 1 O47669 COX2_CANAU
186.8 B,O Cytochrome c oxidase subunit 1 O47678 COX2_LYCSE
186.8 B,O Cytochrome c oxidase subunit 1 O47679 COX2_SPEVE
186.8 B,O Cytochrome c oxidase subunit 1 P50691 COX2_SCICA
187.6 B,O Cytochrome c oxidase subunit 1 O47674 COX2_LYCPI
186.0 B,O Cytochrome c oxidase subunit 1 Q539C6 COX2_VULCO
186.8 B,O Cytochrome c oxidase subunit 1 O47676 COX2_LYCCU
184.2 B,O Cytochrome c oxidase subunit 1 Q37548 COX2_MACCA
186.8 B,O Cytochrome c oxidase subunit 1 Q7IZ21 COX2_TAMAM
186.8 B,O Cytochrome c oxidase subunit 1 Q7IZ15 COX2_TAMCA
186.8 B,O Cytochrome c oxidase subunit 1 Q7IZ14 COX2_TAMCI
186.8 B,O Cytochrome c oxidase subunit 1 Q7IZ11 COX2_TAMDO
186.8 B,O Cytochrome c oxidase subunit 1 Q7IZ08 COX2_TAMMR
186.8 B,O Cytochrome c oxidase subunit 1 Q7IZ01 COX2_TAMPL
186.8 B,O Cytochrome c oxidase subunit 1 Q9G1N5 COX2_TAMRF
186.8 B,O Cytochrome c oxidase subunit 1 Q9G0U1 COX2_TAMSO
186.0 B,O Cytochrome c oxidase subunit 1 O47670 COX2_CHRBR
186.0 B,O Cytochrome c oxidase subunit 1 Q7IZ16 COX2_TAMBU
186.0 B,O Cytochrome c oxidase subunit 1 Q9G5S9 COX2_TAMQA
186.0 B,O Cytochrome c oxidase subunit 1 Q9G185 COX2_TAMTO
185.0 B,O Cytochrome c oxidase subunit 1 P98046 COX2_TARSY
186.0 B,O Cytochrome c oxidase subunit 1 O47677 COX2_LYCGY
184.2 B,O Cytochrome c oxidase subunit 1 P98049 COX2_RABIT
181.4 B,O Cytochrome c oxidase subunit 1 P50687 COX2_DASNO
181.4 B,O Cytochrome c oxidase subunit 1 Q9ZZY8 COX2_HIPAM
184.2 B,O Cytochrome c oxidase subunit 1 O47675 COX2_NYCPR
183.2 B,O Cytochrome c oxidase subunit 1 P98043 COX2_CEPBA
182.4 B,O Cytochrome c oxidase subunit 1 Q8W9N3 COX2_DUGDU
181.4 B,O Cytochrome c oxidase subunit 1 Q37684 COX2_TUPGL
181.4 B,O Cytochrome c oxidase subunit 1 P50683 COX2_CAVAP
181.4 B,O Cytochrome c oxidase subunit 1 Q38RY9 COX2_MAXSU
182.4 B,O Cytochrome c oxidase subunit 1 Q38RY0 COX2_OENHY
183.2 B,O Cytochrome c oxidase subunit 1 Q38S05 COX2_LEGFO
182.4 B,O Cytochrome c oxidase subunit 1 Q38S02 COX2_LEMBA
182.4 B,O Cytochrome c oxidase subunit 1 Q38S00 COX2_LEOSA
182.4 B,O Cytochrome c oxidase subunit 1 P50673 COX2_APOSY
181.4 B,O Cytochrome c oxidase subunit 1 P00405 COX2_MOUSE
181.4 B,O Cytochrome c oxidase subunit 1 Q38S41 COX2_MICNA
182.4 B,O Cytochrome c oxidase subunit 1 P00406 COX2_RAT
181.4 B,O Cytochrome c oxidase subunit 1 Q38S14 COX2_DACMI
181.4 B,O Cytochrome c oxidase subunit 1 Q38S11 COX2_HYBUN
182.4 B,O Cytochrome c oxidase subunit 1 Q38RW5 COX2_PRATU
182.4 B,O Cytochrome c oxidase subunit 1 Q38S23 COX2_BATGR
181.4 B,O Cytochrome c oxidase subunit 1 Q38S20 COX2_BERBO
182.4 B,O Cytochrome c oxidase subunit 1 Q38RZ2 COX2_MAXBA
181.4 B,O Cytochrome c oxidase subunit 1 Q38S17 COX2_CONPN
181.4 B,O Cytochrome c oxidase subunit 1 Q38RU7 COX2_SUNME
182.4 B,O Cytochrome c oxidase subunit 1 Q38S26 COX2_ARVSO
180.6 B,O Cytochrome c oxidase subunit 1 Q38RV6 COX2_RHAPU
180.6 B,O Cytochrome c oxidase subunit 1 Q38S38 COX2_ANIIM
180.6 B,O Cytochrome c oxidase subunit 1 Q38S35 COX2_APOMY
180.6 B,O Cytochrome c oxidase subunit 1 Q38RX1 COX2_PRAJA
200.0 E,R Cytochrome c oxidase subunit 1 P00426 COX5A_BOVIN
200.0 E,R Cytochrome c oxidase subunit 1 B0VYY4 COX5A_EULFU
200.0 E,R Cytochrome c oxidase subunit 1 P12787 COX5A_MOUSE
200.0 E,R Cytochrome c oxidase subunit 1 B0VYY2 COX5A_NYCCO
200.0 E,R Cytochrome c oxidase subunit 1 B0VYY3 COX5A_OTOCR
200.0 E,R Cytochrome c oxidase subunit 1 P11240 COX5A_RAT
192.6 E,R Cytochrome c oxidase subunit 1 B0VYX7 COX5A_COLGU
192.6 E,R Cytochrome c oxidase subunit 1 Q53CF8 COX5A_MACMU
190.8 E,R Cytochrome c oxidase subunit 1 B0VYY5 COX5A_MACPM
190.8 E,R Cytochrome c oxidase subunit 1 P20674 COX5A_HUMAN
190.8 E,R Cytochrome c oxidase subunit 1 B0VYX9 COX5A_CALPY
190.8 E,R Cytochrome c oxidase subunit 1 B0VYY1 COX5A_PLEDO
190.8 E,R Cytochrome c oxidase subunit 1 B0VYY0 COX5A_SAGLB
189.0 E,R Cytochrome c oxidase subunit 1 B0VYX5 COX5A_NOMGA
189.0 E,R Cytochrome c oxidase subunit 1 B0VYX2 COX5A_PANPA
189.0 E,R Cytochrome c oxidase subunit 1 B0VYX1 COX5A_PANTR
189.0 E,R Cytochrome c oxidase subunit 1 B0VYX8 COX5A_PAPAN
189.0 E,R Cytochrome c oxidase subunit 1 B0VYX6 COX5A_SYMSY
187.2 E,R Cytochrome c oxidase subunit 1 B0VYX4 COX5A_PONPY
187.2 E,R Cytochrome c oxidase subunit 1 B0VYX3 COX5A_GORGO
189.0 E,R Cytochrome c oxidase subunit 1 Q53CG1 COX5A_SAISC
200.0 D,Q Cytochrome c oxidase subunit 1 P00423 COX41_BOVIN
186.6 D,Q Cytochrome c oxidase subunit 1 Q95283 COX41_PIG
189.0 D,Q Cytochrome c oxidase subunit 1 O46589 COX41_SAPAP
185.4 D,Q Cytochrome c oxidase subunit 1 O46590 COX41_SAIUS
200.0 G,T Cytochrome c oxidase subunit 1 P07471 CX6A2_BOVIN
200.0 F,S Cytochrome c oxidase subunit 1 P00428 COX5B_BOVIN
187.8 F,S Cytochrome c oxidase subunit 1 Q5S3G4 COX5B_PIG
189.4 F,S Cytochrome c oxidase subunit 1 Q710D6 COX5B_VULVU
200.0 I,V Cytochrome c oxidase subunit 1 P04038 COX6C_BOVIN
180.8 I,V Cytochrome c oxidase subunit 1 Q7YRK7 COX6C_TARSY
200.0 H,U Cytochrome c oxidase subunit 1 P00429 CX6B1_BOVIN
193.0 H,U Cytochrome c oxidase subunit 1 Q7YRK6 CX6B1_TARSY
183.6 H,U Cytochrome c oxidase subunit 1 P56391 CX6B1_MOUSE
200.0 K,X Cytochrome c oxidase subunit 1 P13183 COX7B_BOVIN
200.0 J,W Cytochrome c oxidase subunit 1 P07470 CX7A1_BOVIN
186.2 J,W Cytochrome c oxidase subunit 1 Q8SPJ9 CX7A1_PIG
200.0 J,W Cytochrome c oxidase subunit 1 Q9TR28 CX7A1_SHEEP
200.0 M,Z Cytochrome c oxidase subunit 1 P10175 COX8B_BOVIN
200.0 L,Y Cytochrome c oxidase subunit 1 P00430 COX7C_BOVIN
191.4 L,Y Cytochrome c oxidase subunit 1 Q1W0Y2 COX7C_PIG
187.2 L,Y Cytochrome c oxidase subunit 1 P17665 COX7C_MOUSE
187.2 L,Y Cytochrome c oxidase subunit 1 Q7YRK5 COX7C_TARSY
183.0 L,Y Cytochrome c oxidase subunit 1 P80432 COX7C_RAT