Ligand binding and thermodynamic stability of a multidomain protein, calmodulin.


Abstract

Chemical and thermal denaturation of calmodulin has been monitored spectroscopically to determine the stability for the intact protein and its two isolated domains as a function of binding of Ca2+ or Mg2+. The reversible urea unfolding of either isolated apo-domain follows a two-state mechanism with relatively low deltaG(o)20 values of approximately 2.7 (N-domain) and approximately 1.9 kcal/mol (C-domain). The apo-C-domain is significantly unfolded at normal temperatures (20-25 degrees C). The greater affinity of the C-domain for Ca2+ causes it to be more stable than the N-domain at [Ca2+] > or = 0.3 mM. By contrast, Mg2+ causes a greater stabilization of the N- rather than the C-domain, consistent with measured Mg2+ affinities. For the intact protein (+/-Ca2+), the bimodal denaturation profiles can be analyzed to give two deltaG(o)20 values, which differ significantly from those of the isolated domains, with one domain being less stable and one domain more stable. The observed stability of the domains is strongly dependent on solution conditions such as ionic strength, as well as specific effects due to metal ion binding. In the intact protein, different folding intermediates are observed, depending on the ionic composition. The results illustrate that a protein of low intrinsic stability is liable to major perturbation of its unfolding properties by environmental conditions and liganding processes and, by extension, mutation. Hence, the observed stability of an isolated domain may differ significantly from the stability of the same structure in a multidomain protein. These results address questions involved in manipulating the stability of a protein or its domains by site directed mutagenesis and protein engineering. Study holds ProTherm entries: 9571, 9572, 9573, 9574, 9575, 9576, 9577, 9578, 9579, 9580, 9581, 9583, 9584, 9585, 9586, 9587, 9588, 9589, 9590, 9591, 9592, 9593, 9594, 9595, 9596, 9597, 9598, 9599, 9600, 9601, 9602, 9603, 9604, 9605, 9606, 9607, 9608, 9611, 9612, 9615, 9616, 9617, 9618, 9619, 9620, 9621, 9622, 9623, 9624, 9625, 9626, 9627, 9628, 9629, 9630, 9631, 9632, 9633, 9634, 9635, 9636, 9637, 9638, 9639, 9640, 9641, 9642, 9643, 9644, 9645, 9646, 9647, 9648 Extra Details: transition Tr1C; N-terminal tryptic fragments of calmodulin,apo form calcium binding; calmodulin; chemical denaturation;,circular dichroism; thermal denaturation

Submission Details

ID: FNdzbT973

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:38 p.m.

Version: 1

Publication Details
Masino L;Martin SR;Bayley PM,Protein Sci. (2000) Ligand binding and thermodynamic stability of a multidomain protein, calmodulin. PMID:10975573
Additional Information

Number of data points 121
Proteins Calmodulin ; Calmodulin
Unique complexes 1
Assays/Quantities/Protocols Experimental Assay: Cm ionic:MgCl2: 100 mM ; Experimental Assay: dG_H2O ionic:MgCl2: 100 mM ; Experimental Assay: Cm ionic:MgCl2: 30 mM ; Experimental Assay: dG_H2O ionic:MgCl2: 30 mM ; Experimental Assay: dG ; Experimental Assay: dG ; Experimental Assay: dG ; Experimental Assay: dG ; Experimental Assay: dG ; Experimental Assay: Cm ionic:KCl: 200 M ; Experimental Assay: dG_H2O ionic:KCl: 200 M ; Experimental Assay: Cm ionic:KCl: 100 M ; Experimental Assay: dG_H2O ionic:KCl: 100 M ; Experimental Assay: Cm ionic:KCl: 30 M ; Experimental Assay: dG_H2O ionic:KCl: 30 M ; Experimental Assay: dG pH:7.5, buffers:HEPES: 10 mM, ionic:KCl: 0.2 M ; Experimental Assay: dG pH:7.5, ionic:KCl: 0.1 M, buffers:HEPES: 10 mM ; Experimental Assay: dG pH:7.5, ionic:: , buffers:HEPES: 10 mM ; Experimental Assay: Tm pH:7.5, buffers:HEPES: 10 mM, ionic:KCl: 0.2 M ; Experimental Assay: dHvH pH:7.5, buffers:HEPES: 10 mM, ionic:KCl: 0.2 M ; Experimental Assay: Tm ionic:KCl: 0.1 M, pH:7.5, buffers:HEPES: 10 mM ; Experimental Assay: dHvH ionic:KCl: 0.1 M, pH:7.5, buffers:HEPES: 10 mM ; Experimental Assay: Tm pH:7.5, ionic:: , buffers:HEPES: 10 mM ; Experimental Assay: dHvH pH:7.5, ionic:: , buffers:HEPES: 10 mM ; Experimental Assay: dG temp:37.0 C ; Experimental Assay: dG ; Experimental Assay: Tm ionic:KCl: 100 mM, buffers:Tris: 25 mM, pH:8.0 ; Experimental Assay: dHvH ionic:KCl: 100 mM, buffers:Tris: 25 mM, pH:8.0 ; Experimental Assay: Cm ionic:KCl: 100 mM ; Experimental Assay: dG_H2O ionic:KCl: 100 mM ; Experimental Assay: Cm ionic:KCl: 100 mM ; Experimental Assay: dG_H2O ionic:KCl: 100 mM ; Experimental Assay: Cm ionic:KCl: 100 mM ; Experimental Assay: dG_H2O ionic:KCl: 100 mM ; Experimental Assay: Cm ionic:KCl: 100 mM ; Experimental Assay: dG_H2O ionic:KCl: 100 mM ; Experimental Assay: Cm ionic:KCl: 100 mM ; Experimental Assay: dG_H2O ionic:KCl: 100 mM ; Experimental Assay: Cm ionic:KCl: 100 mM ; Experimental Assay: dG_H2O ionic:KCl: 100 mM
Libraries Mutations for sequence A:ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK/B:KRRWKKNFIAVSAANRFKKISSSGAL
Sequence Assay Result Units