Tolerance of T4 lysozyme to proline substitutions within the long interdomain alpha-helix illustrates the adaptability of proteins to potentially destabilizing lesions.


Abstract

To investigate the ability of a protein to accommodate potentially destabilizing amino acid substitutions, and also to investigate the steric requirements for catalysis, proline was substituted at different sites within the long alpha-helix that connects the amino-terminal and carboxyl-terminal domains of T4 lysozyme. Of the four substitutions attempted, three yielded folded, functional proteins. The catalytic activities of these three mutant proteins (Q69P, D72P, and A74P) were 60-90% that of wild-type. Their melting temperatures were 7-12 degrees C less than that of wild-type at pH 6.5. Mutant D72P formed crystals isomorphous with wild-type allowing the structure to be determined at high resolution. In the crystal structure of wild-type lysozyme the interdomain alpha-helix has an overall bend angle of 8.5 degrees. In the mutant structure the introduction of the proline causes this bend angle to increase to 14 degrees and also causes a corresponding rotation of 5.5 degrees of carboxyl-terminal domain relative to the amino-terminal one. Except for the immediate location of the proline substitution there is very little change in the geometry of the interdomain alpha-helix. The results support the view that protein structures are adaptable and can compensate for potentially destabilizing amino acid substitutions. The results also suggest that the precise shape of the active site cleft of T4 lysozyme is not critical for catalysis. Study holds ProTherm entries: 1171, 1172, 1173, 1174, 1175, 1176, 1177, 1178, 1179, 1180, 1181, 1182, 1183, 13578, 13579, 13580, 13581, 13582, 13583, 13584, 13585 Extra Details: cysteine-free pseudo wild type lysozyme, 1L63 (C54T, C97A) T4 lysozyme; proline; alpha-helix; amino acid substitution;,melting temperature

Submission Details

ID: F2wsMcHk

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:16 p.m.

Version: 1

Publication Details
Sauer UH;San DP;Matthews BW,J. Biol. Chem. (1992) Tolerance of T4 lysozyme to proline substitutions within the long interdomain alpha-helix illustrates the adaptability of proteins to potentially destabilizing lesions. PMID:1733941
Additional Information

Study Summary

Number of data points 54
Proteins Endolysin ; Endolysin ; Endolysin
Unique complexes 4
Assays/Quantities/Protocols Experimental Assay: activity temp:65.7 C, buffers:Potassium phosphate: 10 mM, pH:5.5 ; Experimental Assay: ddG temp:65.7 C, buffers:Potassium phosphate: 10 mM, pH:5.5 ; Experimental Assay: activity buffers:Potassium phosphate: 10 mM, pH:4.0, temp:62.2 C ; Experimental Assay: ddG buffers:Potassium phosphate: 10 mM, pH:4.0, temp:62.2 C ; Experimental Assay: activity buffers:Potassium phosphate: 10 mM, temp:57.5 C, pH:3.5 ; Experimental Assay: ddG buffers:Potassium phosphate: 10 mM, temp:57.5 C, pH:3.5 ; Experimental Assay: activity buffers:Potassium phosphate: 10 mM, pH:6.5, temp:62.9 C ; Experimental Assay: ddG buffers:Potassium phosphate: 10 mM, pH:6.5, temp:62.9 C ; Experimental Assay: activity buffers:Potassium phosphate: 10 mM, pH:6.5, temp:63.4 C ; Experimental Assay: ddG buffers:Potassium phosphate: 10 mM, pH:6.5, temp:63.4 C ; Experimental Assay: activity buffers:Potassium phosphate: 10 mM, temp:63.2 C, pH:6.5 ; Experimental Assay: ddG buffers:Potassium phosphate: 10 mM, temp:63.2 C, pH:6.5 ; Experimental Assay: activity buffers:HCl: 10 mM, temp:38.5 C, pH:2.0 ; Experimental Assay: ddG buffers:HCl: 10 mM, pH:2.0, temp:38.5 C ; Experimental Assay: activity buffers:Potassium phosphate: 10 mM, pH:5.5 ; Experimental Assay: Tm buffers:Potassium phosphate: 10 mM, pH:5.5 ; Experimental Assay: activity buffers:Potassium phosphate: 10 mM, pH:4.0 ; Experimental Assay: Tm buffers:Potassium phosphate: 10 mM, pH:4.0 ; Experimental Assay: activity buffers:Potassium phosphate: 10 mM, pH:3.5 ; Experimental Assay: Tm buffers:Potassium phosphate: 10 mM, pH:3.5 ; Experimental Assay: activity buffers:Potassium phosphate: 10 mM, pH:6.5 ; Experimental Assay: Tm buffers:Potassium phosphate: 10 mM, pH:6.5 ; Experimental Assay: activity buffers:HCl: 10 mM, pH:2.0 ; Experimental Assay: Tm buffers:HCl: 10 mM, pH:2.0 ; Derived Quantity: dTm buffers:Potassium phosphate: 10 mM, pH:5.5 ; Derived Quantity: dTm buffers:Potassium phosphate: 10 mM, pH:4.0 ; Derived Quantity: dTm buffers:Potassium phosphate: 10 mM, pH:3.5 ; Derived Quantity: dTm buffers:Potassium phosphate: 10 mM, pH:6.5 ; Derived Quantity: dTm buffers:HCl: 10 mM, pH:2.0
Libraries Mutations for sequence MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant PDB Entries

Structure ID Release Date Resolution Structure Title
2LC9 2011-08-17 Solution Structure of a Minor and Transiently Formed State of a T4 Lysozyme Mutant
5XPE 2017-10-04 Neutron structure of the T26H mutant of T4 lysozyme
2LCB 2011-08-17 Solution Structure of a Minor and Transiently Formed State of a T4 Lysozyme Mutant
2O7A 2007-04-10 0.84 T4 lysozyme C-terminal fragment
5JDT 2016-09-28 1.0 Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
5XPF 2017-10-04 1.04 High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 2018-09-26 1.05 Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl acetate bound to DCN1
1SWZ 2005-01-18 1.06 Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure determination by direct methods
1SWY 2004-11-23 1.06 Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure Determination
1SX7 2004-11-30 1.06 Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure determination by direct methods
1SX2 2004-11-23 1.06 Use of a Halide Binding Site to Bypass the 1000-atom Limit to Structure Determination by Direct Methods
3F8V 2009-02-17 1.08 Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the Temperature Sensitive T4 Lysozyme Mutant Arg96-->His
3FA0 2009-02-17 1.09 Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the Temperature Sensitive T4 Lysozyme Mutant Arg96-->His
6BG5 2018-09-26 1.1 Structure of 1-(benzo[d][1,3]dioxol-5-ylmethyl)-1-(1-propylpiperidin-4-yl)-3-(3-(trifluoromethyl)phenyl)urea bound to DCN1
5LWO 2017-03-08 1.18 Structure of Spin-labelled T4 lysozyme mutant L115C-R119C-R1 at 100K
3F9L 2009-02-17 1.19 Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the Temperature Sensitive T4 Lysozyme Mutant Arg96-->His
3FAD 2009-02-17 1.2 Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the Temperature Sensitive T4 Lysozyme Mutant Arg96-->His
3HH5 2009-10-13 1.25 New azaborine compounds bind to the T4 lysozyme L99A cavity - 1-ethyl-2-hydro-1,2-azaborine
3HH3 2009-10-13 1.25 New azaborine compounds bind to the T4 lysozyme L99A cavity - 1,2-dihydro-1,2-azaborine
3DKE 2008-11-25 1.25 Polar and non-polar cavities in phage T4 lysozyme
3HH4 2009-10-13 1.25 New azaborine compounds bind to the T4 lysozyme L99A cavity - Benzene as control
3HH6 2009-10-13 1.25 New azaborine compounds bind to the T4 lysozyme L99A cavity -ethylbenzene as control
3HTG 2009-11-03 1.26 2-ethoxy-3,4-dihydro-2h-pyran in complex with T4 lysozyme L99A/M102Q
3HUK 2009-11-03 1.29 Benzylacetate in complex with T4 lysozyme L99A/M102Q
2RBO 2008-03-18 1.29 2-nitrothiophene in complex with T4 lysozyme L99A/M102Q
2RBN 2008-03-18 1.29 N-phenylglycinonitrile in complex with T4 lysozyme L99A/M102Q
4E97 2012-09-05 1.3 T4 Lysozyme L99A/M102H with 2-Mercaptoethanol Bound
5JWV 2016-09-21 1.3 T4 Lysozyme L99A/M102Q with Ethylbenzene Bound
6D9M 2019-04-10 1.35 T4-Lysozyme fusion to Geobacter GGDEF
5V7D 2018-06-20 1.35 T4 lysozyme Y18Ymbr
5V7E 2018-06-20 1.36 T4 lysozyme Y18Ymcl
5V86 2017-05-24 1.37 Structure of DCN1 bound to NAcM-OPT
4W59 2015-04-01 1.39 T4 Lysozyme L99A with n-Hexylbenzene Bound
2NTG 2007-06-12 1.4 Structure of Spin-labeled T4 Lysozyme Mutant T115R7
3HUA 2009-11-03 1.4 4,5,6,7-tetrahydroindole in complex with T4 lysozyme L99A/M102Q
2Q9D 2007-06-26 1.4 Structure of spin-labeled T4 lysozyme mutant A41R1
3HTD 2009-11-03 1.4 (Z)-Thiophene-2-carboxaldoxime in complex with T4 lysozyme L99A/M102Q
3RUN 2012-06-06 1.4 New strategy to analyze structures of glycopeptide antibiotic-target complexes
2IGC 2007-06-12 1.4 Structure of Spin labeled T4 Lysozyme Mutant T115R1A
5JWT 2016-09-21 1.41 T4 Lysozyme L99A/M102Q with Benzene Bound
2RBR 2008-03-18 1.43 2-phenoxyethanol in complex with T4 lysozyme L99A/M102Q
3SBB 2011-09-21 1.43 Disulphide-mediated Tetramer of T4 Lysozyme R76C/R80C by Synthetic Symmetrization
4W51 2015-04-01 1.45 T4 Lysozyme L99A with No Ligand Bound
1P36 2003-10-07 1.45 T4 LYOSZYME CORE REPACKING MUTANT I100V/TA
1LW9 2003-05-20 1.45 Multiple methionine substitutions are tolerated in T4 lysozyme and have coupled effects on folding and stability
3GUI 2009-08-25 1.45 T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--Apo structure
3HUQ 2009-11-03 1.45 Thieno[3,2-b]thiophene in complex with T4 lysozyme L99A/M102Q
2F2Q 2006-04-25 1.45 High resolution crystal strcuture of T4 lysozyme mutant L20R63/A liganded to guanidinium ion
3HU9 2009-11-03 1.46 Nitrosobenzene in complex with T4 lysozyme L99A/M102Q
5JGR 2017-02-15 1.46 Spin-Labeled T4 Lysozyme Construct K43V1
5KI1 2017-04-12 1.46 PSEUDO T4 LYSOZYME MUTANT - Y18F
2RB2 2008-03-18 1.46 3-methylbenzylazide in complex with T4 lysozyme L99A
2RBP 2008-03-18 1.47 2-(n-propylthio)ethanol in complex with T4 lysozyme L99A/M102Q
5JGU 2017-02-15 1.47 Spin-Labeled T4 Lysozyme Construct R119V1
5KGR 2017-02-15 1.47 Spin-Labeled T4 Lysozyme Construct I9V1/V131V1 (30 days)
5JWW 2016-09-21 1.47 T4 Lysozyme L99A/M102Q with 1-Hydro-2-ethyl-1,2-azaborine Bound
4I7M 2013-03-27 1.48 T4 Lysozyme L99A/M102H with 2-allylphenol bound
5KHZ 2017-04-12 1.49 PSEUDO T4 LYSOZYME
4EKR 2012-09-05 1.49 T4 Lysozyme L99A/M102H with 2-Cyanophenol Bound
5KIG 2017-04-12 1.5 PSEUDO T4 LYSOZYME MUTANT - Y88F
5KI2 2017-04-12 1.5 PSEUDO T4 LYSOZYME MUTANT - Y18PHE-METHYL
3K2R 2010-10-13 1.5 Crystal Structure of Spin Labeled T4 Lysozyme Mutant K65V1/R76V1
3GUN 2009-08-25 1.5 T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--aniline binding
3GUP 2009-08-25 1.5 T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--pyridine binding
4W52 2015-04-01 1.5 T4 Lysozyme L99A with Benzene Bound
1P7S 2003-10-07 1.5 T4 LYSOZYME CORE REPACKING MUTANT V103I/TA
5KIM 2017-04-12 1.5 PSEUDO T4 LYSOZYME MUTANT - Y88PHE-I
1PQM 2003-10-07 1.52 T4 Lysozyme Core Repacking Mutant V149I/T152V/TA
4I7R 2013-03-27 1.52 T4 Lysozyme L99A/M102H with 2-(pyrazolo-1-yl) ethanol bound
4I7L 2013-04-03 1.52 T4 Lysozyme L99A/M102H with phenol bound
3FI5 2009-02-17 1.53 Crystal Structure of T4 Lysozyme Mutant R96W
5JGX 2017-02-15 1.53 Spin-Labeled T4 Lysozyme Construct V131V1
5JGZ 2017-02-15 1.53 Spin-Labeled T4 Lysozyme Construct T151V1
5JGN 2017-02-15 1.53 Spin-Labeled T4 Lysozyme Construct I9V1
1P6Y 2003-10-07 1.54 T4 LYSOZYME CORE REPACKING MUTANT M120Y/TA
4EKQ 2012-09-05 1.54 T4 Lysozyme L99A/M102H with 4-Nitrophenol Bound
4I7T 2013-03-27 1.55 T4 Lysozyme L99A/M102H with 2-bromo-5-hydroxybenzaldehyde bound
1XEP 2005-05-31 1.55 Catechol in complex with T4 lysozyme L99A/M102Q
5KI8 2017-04-12 1.55 PSEUDO T4 LYSOZYME MUTANT - Y88PHE-BR
1P3N 2003-10-07 1.55 CORE REDESIGN BACK-REVERTANT I103V/CORE10
2OU9 2007-06-12 1.55 Structure of Spin-labeled T4 Lysozyme Mutant T115R1/R119A
5KII 2017-04-12 1.56 PSEUDO T4 LYSOZYME MUTANT - Y88PHE-METHYL
4W53 2015-04-01 1.56 T4 Lysozyme L99A with Toluene Bound
2RBS 2008-03-18 1.56 (r)(+)-3-chloro-1-phenyl-1-propanol in complex with T4 lysozyme L99A/M102Q
1P37 2003-10-07 1.57 T4 LYSOZYME CORE REPACKING BACK-REVERTANT L102M/CORE10
1PQI 2003-10-07 1.57 T4 LYSOZYME CORE REPACKING MUTANT I118L/CORE7/TA
4I7Q 2013-03-27 1.58 T4 Lysozyme L99A/M102H with 4-trifluoromethylimidazole bound
4I7N 2013-03-27 1.58 T4 Lysozyme L99A/M102H with 1-phenyl-2-propyn-1-ol bound
1P2L 2003-10-07 1.58 T4 Lysozyme Core Repacking Mutant V87I/TA
1P2R 2003-10-07 1.58 T4 LYSOZYME CORE REPACKING MUTANT I78V/TA
3HT6 2009-11-03 1.59 2-methylphenol in complex with T4 lysozyme L99A/M102Q
3HT8 2009-11-03 1.6 5-chloro-2-methylphenol in complex with T4 lysozyme L99A/M102Q
4I7P 2013-03-27 1.6 T4 Lysozyme L99A/M102H with 4-bromoimidazole bound
5V88 2017-05-24 1.6 Structure of DCN1 bound to NAcM-COV
1ZUR 2006-10-17 1.6 Crystal structure of spin labeled T4 Lysozyme (V131R1F)
3GUJ 2009-08-25 1.6 T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--Benzene binding
5G27 2016-11-23 1.61 Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at Room Temperature
1P64 2003-10-07 1.62 T4 LYSOZYME CORE REPACKING MUTANT L133F/TA
4W56 2015-04-01 1.63 T4 Lysozyme L99A with sec-Butylbenzene Bound
2RBQ 2008-03-18 1.63 3-methylbenzylazide in complex with T4 L99A/M102Q
3CDT 2009-02-17 1.63 Contributions of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme
5VNR 2017-07-26 1.63 X-ray strucutre of perdeuterated T4 lysozyme cysteine-free pseudo-wild type at cryogenic temperature
5KIO 2017-04-12 1.63 PSEUDO T4 LYSOZYME MUTANT - Y18PHE-I
4EKP 2012-09-05 1.64 T4 Lysozyme L99A/M102H with Nitrobenzene Bound
4EKS 2012-09-05 1.64 T4 Lysozyme L99A/M102H with Isoxazole Bound
3C8Q 2009-02-17 1.64 Contribution of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme
4W55 2015-04-01 1.64 T4 Lysozyme L99A with n-Propylbenzene Bound
2RAZ 2008-03-18 1.64 4-(methylthio)nitrobenzene in complex with T4 lysozyme L99A
1PQD 2003-10-07 1.65 T4 LYSOZYME CORE REPACKING MUTANT CORE10/TA
5JWS 2016-09-21 1.65 T4 Lysozyme L99A with 1-Hydro-2-ethyl-1,2-azaborine Bound
3DMV 2008-11-11 1.65 Free of ligand binding in the hydrophobic cavity of T4 lysozyme L99A mutant
119L 1993-10-31 1.65 THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME
1PQO 2003-10-07 1.65 T4 Lysozyme Core Repacking Mutant L118I/TA
5KI3 2017-04-12 1.65 PSEUDO T4 LYSOZYME MUTANT - Y18PHE-BR
1L58 1991-10-15 1.65 ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME
1LPY 2002-05-22 1.65 Multiple Methionine Substitutions in T4 Lysozyme
5V7F 2018-06-20 1.65 T4 lysozyme Y18Ymi
219L 1996-12-23 1.66 PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME
4I7J 2013-03-27 1.67 T4 Lysozyme L99A/M102H with benzene bound
1P46 2003-10-07 1.67 T4 lysozyme core repacking mutant M106I/TA
3C7Z 2009-02-17 1.67 T4 lysozyme mutant D89A/R96H at room temperature
4W57 2015-04-01 1.68 T4 Lysozyme L99A with n-Butylbenzene Bound
3CDQ 2009-02-17 1.68 Contributions of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme
3C82 2009-02-17 1.68 Bacteriophage lysozyme T4 lysozyme mutant K85A/R96H
3C8S 2009-02-17 1.68 Contributions of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme
4I7S 2013-03-27 1.69 T4 Lysozyme L99A/M102H with 3-trifluoromethyl-5-methyl pyrazole bound
1L46 1991-10-15 1.7 CUMULATIVE SITE-DIRECTED CHARGE-CHANGE REPLACEMENTS IN BACTERIOPHAGE T4 LYSOZYME SUGGEST THAT LONG-RANGE ELECTROSTATIC INTERACTIONS CONTRIBUTE LITTLE TO PROTEIN STABILITY
1L62 1991-10-15 1.7 ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME
128L 1993-10-31 1.7 THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME
1L45 1991-10-15 1.7 CUMULATIVE SITE-DIRECTED CHARGE-CHANGE REPLACEMENTS IN BACTERIOPHAGE T4 LYSOZYME SUGGEST THAT LONG-RANGE ELECTROSTATIC INTERACTIONS CONTRIBUTE LITTLE TO PROTEIN STABILITY
5JWU 2016-09-21 1.7 T4 Lysozyme L99A/M102Q with 1,2-Dihydro-1,2-azaborine Bound
1L36 1991-10-15 1.7 TOWARD A SIMPLIFICATION OF THE PROTEIN FOLDING PROBLEM: A STABILIZING POLYALANINE ALPHA-HELIX ENGINEERED IN T4 LYSOZYME
1L02 1988-04-16 1.7 CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME
139L 1994-01-31 1.7 RAPID CRYSTALLIZATION OF T4 LYSOZYME BY INTERMOLECULAR DISULFIDE CROSSLINKING
131L 1994-01-31 1.7 STRUCTURES OF RANDOMLY GENERATED MUTANTS OF T4 LYSOZYME SHOW THAT PROTEIN STABILITY CAN BE ENHANCED BY RELAXATION OF STRAIN AND BY IMPROVED HYDROGEN BONDING VIA BOUND SOLVENT
4LZM 1992-07-15 1.7 COMPARISON OF THE CRYSTAL STRUCTURE OF BACTERIOPHAGE T4 LYSOZYME AT LOW, MEDIUM, AND HIGH IONIC STRENGTHS
1L04 1988-04-16 1.7 CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME
1L10 1988-04-16 1.7 STRUCTURAL STUDIES OF MUTANTS OF THE LYSOZYME OF BACTERIOPHAGE T4. THE TEMPERATURE-SENSITIVE MUTANT PROTEIN THR157 (RIGHT ARROW) ILE
1L13 1988-04-16 1.7 CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME
2RB1 2008-06-03 1.7 2-ethoxyphenol in complex with T4 lysozyme L99A
237L 1998-03-18 1.7 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
1L06 1988-04-16 1.7 CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME
1L26 1990-01-15 1.7 REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY
1G0M 2001-05-23 1.7 CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT T152I
1L11 1988-04-16 1.7 CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME
1KNI 2001-12-28 1.7 Stabilizing Disulfide Bridge Mutant of T4 Lysozyme
1L83 1993-10-31 1.7 A CAVITY-CONTAINING MUTANT OF T4 LYSOZYME IS STABILIZED BY BURIED BENZENE
217L 1993-10-31 1.7 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
1L18 1990-01-15 1.7 HYDROPHOBIC STABILIZATION IN T4 LYSOZYME DETERMINED DIRECTLY BY MULTIPLE SUBSTITUTIONS OF ILE 3
1L15 1988-04-16 1.7 CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME
129L 1994-01-31 1.7 STRUCTURES OF RANDOMLY GENERATED MUTANTS OF T4 LYSOZYME SHOW THAT PROTEIN STABILITY CAN BE ENHANCED BY RELAXATION OF STRAIN AND BY IMPROVED HYDROGEN BONDING VIA BOUND SOLVENT
1L03 1988-04-16 1.7 CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME
1L17 1990-01-15 1.7 HYDROPHOBIC STABILIZATION IN T4 LYSOZYME DETERMINED DIRECTLY BY MULTIPLE SUBSTITUTIONS OF ILE 3
2F47 2006-04-25 1.7 Xray crystal structure of T4 lysozyme mutant L20/R63A liganded to methylguanidinium
1L07 1988-04-16 1.7 CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME
3DNA 2008-11-11 1.7 Iodobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant (seleno version)
1L65 1991-10-15 1.7 TOLERANCE OF T4 LYSOZYME TO MULTIPLE XAA (RIGHT ARROW) ALA SUBSTITUTIONS: A POLYALANINE ALPHA-HELIX CONTAINING TEN CONSECUTIVE ALANINES
1L16 1988-04-16 1.7 STRUCTURAL ANALYSIS OF THE TEMPERATURE-SENSITIVE MUTANT OF BACTERIOPHAGE T4 LYSOZYME, GLYCINE 156 (RIGHT ARROW) ASPARTIC ACID
1L33 1990-01-15 1.7 CONTRIBUTIONS OF LEFT-HANDED HELICAL RESIDUES TO THE STRUCTURE AND STABILITY OF BACTERIOPHAGE T4 LYSOZYME
1L47 1991-10-15 1.7 CUMULATIVE SITE-DIRECTED CHARGE-CHANGE REPLACEMENTS IN BACTERIOPHAGE T4 LYSOZYME SUGGEST THAT LONG-RANGE ELECTROSTATIC INTERACTIONS CONTRIBUTE LITTLE TO PROTEIN STABILITY
1L29 1990-01-15 1.7 REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY
241L 1998-03-18 1.7 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
161L 1994-08-31 1.7 CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND
1L05 1988-04-16 1.7 CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME
2LZM 1986-10-24 1.7 STRUCTURE OF BACTERIOPHAGE T4 LYSOZYME REFINED AT 1.7 ANGSTROMS RESOLUTION
1LWG 2003-05-20 1.7 Multiple Methionine Substitutions are Tolerated in T4 Lysozyme and have Coupled Effects on Folding and Stability
3LZM 1990-01-15 1.7 STRUCTURAL STUDIES OF MUTANTS OF T4 LYSOZYME THAT ALTER HYDROPHOBIC STABILIZATION
1L12 1988-04-16 1.7 CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME
138L 1994-01-31 1.7 RAPID CRYSTALLIZATION OF T4 LYSOZYME BY INTERMOLECULAR DISULFIDE CROSSLINKING
1L32 1990-01-15 1.7 REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY
1L74 1991-10-15 1.7 MULTIPLE STABILIZING ALANINE REPLACEMENTS WITHIN ALPHA-HELIX 126-134 OF T4 LYSOZYME HAVE INDEPENDENT, ADDITIVE EFFECTS ON BOTH STRUCTURE AND STABILITY
2A4T 2006-06-13 1.7 Crystal structure of spin labeled T4 Lysozyme (V131R7)
1L23 1990-01-15 1.7 ENHANCED PROTEIN THERMOSTABILITY FROM SITE-DIRECTED MUTATIONS THAT DECREASE THE ENTROPY OF UNFOLDING
3DN8 2008-11-11 1.7 Iodopentafluorobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant (seleno version)
1L52 1991-10-15 1.7 STRUCTURAL AND THERMODYNAMIC ANALYSIS OF THE PACKING OF TWO ALPHA-HELICES IN BACTERIOPHAGE T4 LYSOZYME
173L 1995-07-10 1.7 PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME
1L08 1988-04-16 1.7 CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME
1L48 1991-10-15 1.7 STRUCTURAL AND THERMODYNAMIC ANALYSIS OF THE PACKING OF TWO ALPHA-HELICES IN BACTERIOPHAGE T4 LYSOZYME
3HT7 2009-11-03 1.7 2-ethylphenol in complex with T4 lysozyme L99A/M102Q
1L68 1991-10-15 1.7 TOLERANCE OF T4 LYSOZYME TO MULTIPLE XAA (RIGHT ARROW) ALA SUBSTITUTIONS: A POLYALANINE ALPHA-HELIX CONTAINING TEN CONSECUTIVE ALANINES
1LYH 1993-10-31 1.7 DISSECTION OF HELIX CAPPING IN T4 LYSOZYME BY STRUCTURAL AND THERMODYNAMIC ANALYSIS OF SIX AMINO ACID SUBSTITUTIONS AT THR 59
1ZYT 2006-08-15 1.7 Crystal structure of spin labeled T4 Lysozyme (A82R1)
1L66 1991-10-15 1.7 TOLERANCE OF T4 LYSOZYME TO MULTIPLE XAA (RIGHT ARROW) ALA SUBSTITUTIONS: A POLYALANINE ALPHA-HELIX CONTAINING TEN CONSECUTIVE ALANINES
1L19 1990-01-15 1.7 ENHANCED PROTEIN THERMOSTABILITY FROM DESIGNED MUTATIONS THAT INTERACT WITH ALPHA-HELIX DIPOLES
211L 1996-12-23 1.7 PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME
1L09 1988-04-16 1.7 CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME
221L 1994-01-31 1.7 THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME
3CDR 2009-02-17 1.7 R96Q Mutant of wildtype phage T4 lysozyme at 298 K
244L 1998-03-18 1.7 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
1L22 1990-01-15 1.7 CONTRIBUTIONS OF LEFT-HANDED HELICAL RESIDUES TO THE STRUCTURE AND STABILITY OF BACTERIOPHAGE T4 LYSOZYME
1L60 1991-10-15 1.7 ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME
1L92 1993-10-31 1.7 SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES
1G07 2001-05-23 1.7 CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT V149C
130L 1994-01-31 1.7 STRUCTURES OF RANDOMLY GENERATED MUTANTS OF T4 LYSOZYME SHOW THAT PROTEIN STABILITY CAN BE ENHANCED BY RELAXATION OF STRAIN AND BY IMPROVED HYDROGEN BONDING VIA BOUND SOLVENT
1L30 1990-01-15 1.7 REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY
1L44 1991-10-15 1.7 CUMULATIVE SITE-DIRECTED CHARGE-CHANGE REPLACEMENTS IN BACTERIOPHAGE T4 LYSOZYME SUGGEST THAT LONG-RANGE ELECTROSTATIC INTERACTIONS CONTRIBUTE LITTLE TO PROTEIN STABILITY
110L 1993-10-31 1.7 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
1L14 1988-04-16 1.7 CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME
1L24 1990-01-15 1.7 ENHANCED PROTEIN THERMOSTABILITY FROM SITE-DIRECTED MUTATIONS THAT DECREASE THE ENTROPY OF UNFOLDING
1L01 1988-04-16 1.7 STRUCTURAL STUDIES OF MUTANTS OF THE LYSOZYME OF BACTERIOPHAGE T4. THE TEMPERATURE-SENSITIVE MUTANT PROTEIN THR157 (RIGHT ARROW) ILE
4I7K 2013-03-27 1.72 T4 Lysozyme L99A/M102H with toluene bound
4I7O 2013-03-27 1.73 T4 Lysozyme L99A/M102H with 2-amino-5-chlorothiazole bound
5JGV 2017-02-15 1.73 Spin-Labeled T4 Lysozyme Construct A73V1
232L 1998-01-14 1.73 T4 LYSOZYME MUTANT M120K
3CDV 2009-02-17 1.73 Contributions of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme
4EPI 2012-06-20 1.74 The crystal structure of pesticin-T4 lysozyme hybrid stabilized by engineered disulfide bonds
102L 1993-10-31 1.74 HOW AMINO-ACID INSERTIONS ARE ALLOWED IN AN ALPHA-HELIX OF T4 LYSOZYME
1L63 1991-10-15 1.75 ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME
1L90 1993-10-31 1.75 SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES
1L59 1991-10-15 1.75 ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME
5I14 2016-02-17 1.75 Truncated and mutated T4 lysozyme
1KW5 2003-06-03 1.75 METHIONINE CORE MUTANT OF T4 LYSOZYME
243L 1998-03-18 1.75 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
1DYB 1993-10-31 1.75 DETERMINATION OF ALPHA-HELIX PROPENSITY WITHIN THE CONTEXT OF A FOLDED PROTEIN: SITES 44 AND 131 IN BACTERIOPHAGE T4 LYSOZYME
165L 1994-08-31 1.75 CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND
2CUU 2006-08-15 1.75 Crystal structure of spin labeled T4 Lysozyme (V131R1)
1QUD 1999-07-08 1.75 L99G MUTANT OF T4 LYSOZYME
180L 1996-04-03 1.75 PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME
1L41 1991-10-15 1.75 CONTRIBUTIONS OF ENGINEERED SURFACE SALT BRIDGES TO THE STABILITY OF T4 LYSOZYME DETERMINED BY DIRECTED MUTAGENESIS
206L 1996-08-17 1.75 PHAGE T4 LYSOZYME
240L 1998-03-18 1.75 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
166L 1994-08-31 1.75 CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND
247L 1998-03-18 1.75 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
212L 1996-12-23 1.76 PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME
3C7W 2009-02-17 1.77 Contributions of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme
6FW2 2018-10-31 1.78 Crystal Structure of human mARC1
4W54 2015-04-01 1.79 T4 Lysozyme L99A with Ethylbenzene Bound
113L 1993-10-31 1.8 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
226L 1998-03-18 1.8 GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS
3C8R 2009-02-17 1.8 Contributions of all 20 amino acids at site 96 to stability and structure of T4 lysozyme
1QT5 1999-07-08 1.8 D20E MUTANT STRUCTURE OF T4 LYSOZYME
6LZM 1992-07-15 1.8 COMPARISON OF THE CRYSTAL STRUCTURE OF BACTERIOPHAGE T4 LYSOZYME AT LOW, MEDIUM, AND HIGH IONIC STRENGTHS
3DN6 2008-11-11 1.8 1,3,5-trifluoro-2,4,6-trichlorobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant
162L 1994-08-31 1.8 CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND
1L56 1991-10-15 1.8 ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME
4W58 2015-04-01 1.8 T4 Lysozyme L99A with n-Pentylbenzene Bound
3L2X 2011-01-05 1.8 Crystal Structure of Spin Labeled T4 Lysozyme Mutant 115-119RX
1L98 1993-10-31 1.8 PERTURBATION OF TRP 138 IN T4 LYSOZYME BY MUTATIONS AT GLN 105 USED TO CORRELATE CHANGES IN STRUCTURE, STABILITY, SOLVATION, AND SPECTROSCOPIC PROPERTIES
1CV3 1999-08-24 1.8 T4 LYSOZYME MUTANT L121M
242L 1998-03-18 1.8 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
156L 1994-08-31 1.8 CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND
255L 1998-01-28 1.8 HYDROLASE
238L 1998-03-18 1.8 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
160L 1994-08-31 1.8 CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND
159L 1994-08-31 1.8 CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND
1QT7 1999-07-08 1.8 E11N Mutant of T4 Lysozyme
260L 2000-09-11 1.8 AN ADAPTABLE METAL-BINDING SITE ENGINEERED INTO T4 LYSOZYME
7LZM 1992-07-15 1.8 COMPARISON OF THE CRYSTAL STRUCTURE OF BACTERIOPHAGE T4 LYSOZYME AT LOW, MEDIUM, AND HIGH IONIC STRENGTHS
2F32 2006-04-25 1.8 Xray crystal structure of lysozyme mutant L20/R63A liganded to ethylguanidinium
120L 1993-10-31 1.8 THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME
123L 1993-10-31 1.8 THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME
114L 1993-10-31 1.8 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
1L31 1990-01-15 1.8 REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY
186L 1995-07-10 1.8 SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY
1L25 1990-01-15 1.8 REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY
1G1W 2001-05-09 1.8 T4 LYSOZYME MUTANT C54T/C97A/Q105M
250L 1998-03-18 1.8 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
2O79 2007-04-10 1.8 T4 lysozyme with C-terminal extension
1LYF 1993-10-31 1.8 DISSECTION OF HELIX CAPPING IN T4 LYSOZYME BY STRUCTURAL AND THERMODYNAMIC ANALYSIS OF SIX AMINO ACID SUBSTITUTIONS AT THR 59
1L42 1991-10-15 1.8 CUMULATIVE SITE-DIRECTED CHARGE-CHANGE REPLACEMENTS IN BACTERIOPHAGE T4 LYSOZYME SUGGEST THAT LONG-RANGE ELECTROSTATIC INTERACTIONS CONTRIBUTE LITTLE TO PROTEIN STABILITY
245L 1998-03-18 1.8 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
185L 1995-07-10 1.8 SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY
182L 1995-07-10 1.8 SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY
1CVK 1999-11-10 1.8 T4 LYSOZYME MUTANT L118A
1L35 1990-01-15 1.8 STRUCTURE OF A THERMOSTABLE DISULFIDE-BRIDGE MUTANT OF PHAGE T4 LYSOZYME SHOWS THAT AN ENGINEERED CROSSLINK IN A FLEXIBLE REGION DOES NOT INCREASE THE RIGIDITY OF THE FOLDED PROTEIN
3DN4 2008-11-11 1.8 Iodobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant
3HWL 2009-12-08 1.8 Crystal Structure of T4 lysozyme with the unnatural amino acid p-Acetyl-L-Phenylalanine incorporated at position 131
118L 1993-10-31 1.8 THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME
107L 1993-10-31 1.8 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
256L 1998-05-27 1.8 BACTERIOPHAGE T4 LYSOZYME
1L94 1993-10-31 1.8 SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES
163L 1994-08-31 1.8 CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND
3DMX 2009-01-27 1.8 Benzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant
5LZM 1992-07-15 1.8 COMPARISON OF THE CRYSTAL STRUCTURE OF BACTERIOPHAGE T4 LYSOZYME AT LOW, MEDIUM, AND HIGH IONIC STRENGTHS
1G0L 2001-05-23 1.8 CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT T152V
181L 1995-07-10 1.8 SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY
3HU8 2009-11-03 1.8 2-ethoxyphenol in complex with T4 lysozyme L99A/M102Q
1NHB 1995-07-10 1.8 Specificity of ligand binding in a buried non-polar cavity of t4 lysozyme: linkage of dynamics and structural plasticity
1L49 1991-10-15 1.8 STRUCTURAL AND THERMODYNAMIC ANALYSIS OF THE PACKING OF TWO ALPHA-HELICES IN BACTERIOPHAGE T4 LYSOZYME
1L87 1993-10-31 1.8 SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES
108L 1993-10-31 1.8 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
246L 1998-03-18 1.8 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
1L61 1991-10-15 1.8 ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME
239L 1998-03-18 1.8 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
1L38 1991-10-15 1.8 CONTRIBUTIONS OF ENGINEERED SURFACE SALT BRIDGES TO THE STABILITY OF T4 LYSOZYME DETERMINED BY DIRECTED MUTAGENESIS
2NTH 2007-06-12 1.8 Structure of Spin-labeled T4 Lysozyme Mutant L118R1
1C69 2000-10-04 1.8 T4 LYSOZYME MUTANT C54T/C97A/L133A IN THE PRESENCE OF 8 ATM ARGON
2OU8 2007-06-12 1.8 Structure of Spin-labeled T4 Lysozyme Mutant T115R1 at Room Temperature
187L 1995-07-10 1.8 SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY
1L27 1990-01-15 1.8 REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY
3G3X 2009-05-05 1.8 Crystal structure of spin labeled T4 Lysozyme (T151R1) at 100 K
126L 1993-10-31 1.8 THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME
258L 2000-09-11 1.8 AN ADAPTABLE METAL-BINDING SITE ENGINEERED INTO T4 LYSOZYME
183L 1995-07-10 1.8 SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY
1L91 1993-10-31 1.8 SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES
1L93 1993-10-31 1.8 SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES
122L 1993-10-31 1.8 THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME
2RAY 2008-03-18 1.8 beta-chlorophenetole in complex with T4 lysozyme L99A
1L86 1993-10-31 1.8 SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES
1LYJ 1993-10-31 1.8 DISSECTION OF HELIX CAPPING IN T4 LYSOZYME BY STRUCTURAL AND THERMODYNAMIC ANALYSIS OF SIX AMINO ACID SUBSTITUTIONS AT THR 59
1P56 2004-05-04 1.8 Duplication-extension of Helix A of T4 lysozyme
158L 1994-08-31 1.8 CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND
112L 1993-10-31 1.8 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
1L80 1993-04-15 1.8 DESIGN AND STRUCTURAL ANALYSIS OF ALTERNATIVE HYDROPHOBIC CORE PACKING ARRANGEMENTS IN BACTERIOPHAGE T4 LYSOZYME
229L 1998-03-18 1.8 GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS
1G0Q 2001-05-23 1.8 CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT V149I
1QSB 1999-07-07 1.8 THE INTRODUCTION OF STRAIN AND ITS EFFECTS ON THE STRUCTURE AND STABILITY OF T4 LYSOZYME
3DN1 2008-11-11 1.8 Chloropentafluorobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant
2HUL 2006-10-17 1.8 Crystal structure of T4 Lysozyme S44C synthetic dimer
188L 1995-07-10 1.8 SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY
1LYG 1993-10-31 1.8 DISSECTION OF HELIX CAPPING IN T4 LYSOZYME BY STRUCTURAL AND THERMODYNAMIC ANALYSIS OF SIX AMINO ACID SUBSTITUTIONS AT THR 59
1LLH 2002-05-15 1.8 ARE CARBOXY TERMINII OF HELICES CODED BY THE LOCAL SEQUENCE OR BY TERTIARY STRUCTURE CONTACTS
111L 1993-10-31 1.8 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
1DYE 1993-10-31 1.8 DETERMINATION OF ALPHA-HELIX PROPENSITY WITHIN THE CONTEXT OF A FOLDED PROTEIN: SITES 44 AND 131 IN BACTERIOPHAGE T4 LYSOZYME
3DN0 2008-11-11 1.8 Pentafluorobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant
1L43 1991-10-15 1.8 CUMULATIVE SITE-DIRECTED CHARGE-CHANGE REPLACEMENTS IN BACTERIOPHAGE T4 LYSOZYME SUGGEST THAT LONG-RANGE ELECTROSTATIC INTERACTIONS CONTRIBUTE LITTLE TO PROTEIN STABILITY
1ZWN 2006-10-17 1.8 Crystal structure of spin labeled T4 Lysozyme (V131R1B)
1T8G 2004-10-19 1.8 Crystal structure of phage T4 lysozyme mutant L32A/L33A/T34A/C54T/C97A/E108V
3DN3 2008-11-11 1.8 Iodopentafluorobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant
3DN2 2008-11-11 1.8 Bromopentafluorobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant
184L 1995-07-10 1.8 SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY
1G0J 2001-05-23 1.8 CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT T152S
1LYE 1993-10-31 1.8 DISSECTION OF HELIX CAPPING IN T4 LYSOZYME BY STRUCTURAL AND THERMODYNAMIC ANALYSIS OF SIX AMINO ACID SUBSTITUTIONS AT THR 59
164L 1994-08-31 1.8 CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND
1G0P 2001-05-23 1.8 CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT V149G
115L 1993-10-31 1.8 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
3HTB 2009-11-03 1.81 2-propylphenol in complex with T4 lysozyme L99A/M102Q
2OTY 2007-08-07 1.83 1,2-dichlorobenzene in complex with T4 Lysozyme L99A
3C83 2009-02-17 1.84 Bacteriophage T4 lysozyme mutant D89A in wildtype background at room temperature
2RB0 2008-03-18 1.84 2,6-difluorobenzylbromide complex with T4 lysozyme L99A
1L37 1991-10-15 1.85 CONTRIBUTIONS OF ENGINEERED SURFACE SALT BRIDGES TO THE STABILITY OF T4 LYSOZYME DETERMINED BY DIRECTED MUTAGENESIS
1L50 1991-10-15 1.85 STRUCTURAL AND THERMODYNAMIC ANALYSIS OF THE PACKING OF TWO ALPHA-HELICES IN BACTERIOPHAGE T4 LYSOZYME
3C81 2009-02-17 1.85 Mutant K85A of T4 lysozyme in wildtype background at room temperature
1L20 1990-01-15 1.85 ENHANCED PROTEIN THERMOSTABILITY FROM DESIGNED MUTATIONS THAT INTERACT WITH ALPHA-HELIX DIPOLES
199L 1996-03-08 1.85 THERMODYNAMIC AND STRUCTURAL COMPENSATION IN 'SIZE-SWITCH' CORE-REPACKING VARIANTS OF T4 LYSOZYME
1L53 1991-10-15 1.85 STRUCTURAL AND THERMODYNAMIC ANALYSIS OF THE PACKING OF TWO ALPHA-HELICES IN BACTERIOPHAGE T4 LYSOZYME
1L39 1991-10-15 1.85 CONTRIBUTIONS OF ENGINEERED SURFACE SALT BRIDGES TO THE STABILITY OF T4 LYSOZYME DETERMINED BY DIRECTED MUTAGENESIS
1LGW 2002-05-08 1.85 T4 Lysozyme Mutant L99A/M102Q Bound by 2-fluoroaniline
1L40 1991-10-15 1.85 CONTRIBUTIONS OF ENGINEERED SURFACE SALT BRIDGES TO THE STABILITY OF T4 LYSOZYME DETERMINED BY DIRECTED MUTAGENESIS
224L 1994-01-31 1.85 THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME
1L21 1990-01-15 1.85 CONTRIBUTIONS OF LEFT-HANDED HELICAL RESIDUES TO THE STRUCTURE AND STABILITY OF BACTERIOPHAGE T4 LYSOZYME
1L88 1993-10-31 1.85 SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES
109L 1993-10-31 1.85 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
1L72 1991-10-15 1.85 MULTIPLE STABILIZING ALANINE REPLACEMENTS WITHIN ALPHA-HELIX 126-134 OF T4 LYSOZYME HAVE INDEPENDENT, ADDITIVE EFFECTS ON BOTH STRUCTURE AND STABILITY
127L 1993-10-31 1.85 THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME
220L 1998-03-18 1.85 GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS
1EPY 2000-04-12 1.85 T4 LYSOZYME MUTANT, T21H/C54T/C97A/Q141H/T142H
1QT3 1999-07-08 1.85 T26D MUTANT OF T4 LYSOZYME
1LI3 2002-05-08 1.85 T4 lysozyme mutant L99A/M102Q bound by 3-chlorophenol
1CU2 1999-11-10 1.85 T4 LYSOZYME MUTANT L84M
1G0K 2001-05-23 1.85 CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT T152C
146L 1994-01-31 1.85 ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME
1L71 1991-10-15 1.85 MULTIPLE STABILIZING ALANINE REPLACEMENTS WITHIN ALPHA-HELIX 126-134 OF T4 LYSOZYME HAVE INDEPENDENT, ADDITIVE EFFECTS ON BOTH STRUCTURE AND STABILITY
155L 1994-08-31 1.85 CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND
1QS9 1999-07-02 1.85 THE INTRODUCTION OF STRAIN AND ITS EFFECTS ON THE STRUCTURE AND STABILITY OF T4 LYSOZYME
157L 1994-08-31 1.85 CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND
1QUH 1999-07-08 1.85 L99G/E108V MUTANT OF T4 LYSOZYME
3GUK 2009-08-25 1.85 T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--Toluene binding
1G06 2001-05-23 1.85 CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT V149S
137L 1994-07-31 1.85 STRUCTURAL BASIS OF AMINO ACID ALPHA HELIX PROPENSITY
1L73 1991-10-15 1.85 MULTIPLE STABILIZING ALANINE REPLACEMENTS WITHIN ALPHA-HELIX 126-134 OF T4 LYSOZYME HAVE INDEPENDENT, ADDITIVE EFFECTS ON BOTH STRUCTURE AND STABILITY
125L 1993-10-31 1.85 THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME
3HTF 2009-11-03 1.85 4-chloro-1h-pyrazole in complex with T4 lysozyme L99A/M102Q
1CV5 1999-11-10 1.87 T4 LYSOZYME MUTANT L133M
3CDO 2009-02-17 1.87 Bacteriophage T4 lysozyme mutant R96V in wildtype background at low temperature
210L 1996-12-23 1.89 PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME
1D2W 1999-10-08 1.89 N-TERMINAL DOMAIN CORE METHIONINE MUTATION
214L 1996-12-23 1.89 PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME
1KW7 2003-06-03 1.89 METHIONINE CORE MUTANT OF T4 LYSOZYME
1CUP 1999-11-10 1.89 METHIONINE CORE MUTANT OF T4 LYSOZYME
228L 1998-03-18 1.9 GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS
235L 1998-03-18 1.9 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
1L00 1993-10-31 1.9 PERTURBATION OF TRP 138 IN T4 LYSOZYME BY MUTATIONS AT GLN 105 USED TO CORRELATE CHANGES IN STRUCTURE, STABILITY, SOLVATION, AND SPECTROSCOPIC PROPERTIES
1QT8 1999-07-08 1.9 T26H Mutant of T4 Lysozyme
1L76 1991-10-15 1.9 TOLERANCE OF T4 LYSOZYME TO PROLINE SUBSTITUTIONS WITHIN THE LONG INTERDOMAIN ALPHA-HELIX ILLUSTRATES THE ADAPTABILITY OF PROTEINS TO POTENTIALLY DESTABILIZING LESIONS
148L 1994-04-30 1.9 A COVALENT ENZYME-SUBSTRATE INTERMEDIATE WITH SACCHARIDE DISTORTION IN A MUTANT T4 LYSOZYME
1QTB 1999-07-02 1.9 THE INTRODUCTION OF STRAIN AND ITS EFFECTS ON THE STRUCTURE AND STABILITY OF T4 LYSOZYME
1PQJ 2003-10-07 1.9 T4 LYSOZYME CORE REPACKING MUTANT A111V/CORE10/TA
1L75 1991-10-15 1.9 MULTIPLE STABILIZING ALANINE REPLACEMENTS WITHIN ALPHA-HELIX 126-134 OF T4 LYSOZYME HAVE INDEPENDENT, ADDITIVE EFFECTS ON BOTH STRUCTURE AND STABILITY
1L57 1991-10-15 1.9 ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME
1L34 1990-01-15 1.9 HIGH-RESOLUTION STRUCTURE OF THE TEMPERATURE-SENSITIVE MUTANT OF PHAGE LYSOZYME, ARG 96 (RIGHT ARROW) HIS
1QTH 1999-07-22 1.9 THE INTRODUCTION OF STRAIN AND ITS EFFECTS ON THE STRUCTURE AND STABILITY OF T4 LYSOZYME
1QUG 1999-07-08 1.9 E108V MUTANT OF T4 LYSOZYME
1OWZ 2004-04-13 1.9 T4 Lysozyme Cavity Mutant L99A/M102Q Bound With 4-FluoroPhenEthyl Alcohol
223L 1998-03-18 1.9 GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS
1C6J 2000-10-04 1.9 T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 8 ATM KRYPTON
257L 2000-09-11 1.9 AN ADAPTABLE METAL-BINDING SITE ENGINEERED INTO T4 LYSOZYME
236L 1998-03-18 1.9 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
1L79 1993-04-15 1.9 DESIGN AND STRUCTURAL ANALYSIS OF ALTERNATIVE HYDROPHOBIC CORE PACKING ARRANGEMENTS IN BACTERIOPHAGE T4 LYSOZYME
1LGX 2002-05-08 1.9 T4 Lysozyme Mutant L99A/M102Q Bound by 3,5-difluoroaniline
1L64 1991-10-15 1.9 TOLERANCE OF T4 LYSOZYME TO MULTIPLE XAA (RIGHT ARROW) ALA SUBSTITUTIONS: A POLYALANINE ALPHA-HELIX CONTAINING TEN CONSECUTIVE ALANINES
1C6Q 2000-10-04 1.9 T4 LYSOZYME MUTANT C54T/C97A IN THE PRESENCE OF 8 ATM KRYPTON
1B6I 2000-01-12 1.9 T4 LYSOZYME MUTANT WITH CYS 54 REPLACED BY THR, CYS 97 REPLACED BY ALA, THR 21 REPLACED BY CYS AND LYS 124 REPLACED BY CYS (C54T,C97A,T21C,K124C)
2O4W 2007-04-10 1.9 T4 lysozyme circular permutant
1I6S 2001-05-09 1.9 T4 LYSOZYME MUTANT C54T/C97A/N101A
1CV4 1999-11-10 1.9 T4 LYSOZYME MUTANT L118M
1L89 1993-10-31 1.9 SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES
1L28 1990-01-15 1.9 REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY
225L 1998-03-18 1.9 GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS
1C6P 2000-10-04 1.9 T4 LYSOZYME MUTANT C54T/C97A IN THE PRESENCE OF 8 ATM ARGON
234L 1998-01-14 1.9 T4 LYSOZYME MUTANT M106L
1QUO 1999-07-08 1.9 L99A/E108V MUTANT OF T4 LYSOZYME
1OWY 2004-04-13 1.9 T4 Lysozyme Cavity Mutant L99A/M102Q Bound With 2-Propyl-Aniline
1C6K 2000-10-04 1.9 T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 8 ATM XENON
1L55 1991-10-15 1.9 ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME
1L84 1993-10-31 1.9 A CAVITY-CONTAINING MUTANT OF T4 LYSOZYME IS STABILIZED BY BURIED BENZENE
1QSQ 1999-06-29 1.9 CAVITY CREATING MUTATION
254L 1998-01-28 1.9 LYSOZYME
1L51 1991-10-15 1.9 STRUCTURAL AND THERMODYNAMIC ANALYSIS OF THE PACKING OF TWO ALPHA-HELICES IN BACTERIOPHAGE T4 LYSOZYME
1C6G 2000-10-04 1.9 T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 4 ATM KRYPTON
1C6E 2000-10-04 1.9 T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 2 ATM XENON
172L 1995-07-10 1.9 PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME
233L 1998-01-14 1.9 T4 LYSOZYME MUTANT M120L
1L54 1991-10-15 1.9 THE STRUCTURAL AND THERMODYNAMIC CONSEQUENCES OF BURYING A CHARGED RESIDUE WITHIN THE HYDROPHOBIC CORE OF T4 LYSOZYME
192L 1995-09-15 1.9 A HELIX INITIATION SIGNAL IN T4 LYSOZYME IDENTIFIED BY POLYALANINE MUTAGENESIS
1CV6 1999-11-10 1.9 T4 LYSOZYME MUTANT V149M
249L 1998-03-18 1.9 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
1L69 1991-10-15 1.9 MULTIPLE STABILIZING ALANINE REPLACEMENTS WITHIN ALPHA-HELIX 126-134 OF T4 LYSOZYME HAVE INDEPENDENT, ADDITIVE EFFECTS ON BOTH STRUCTURE AND STABILITY
1G0G 2001-05-23 1.9 CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT T152A
1G1V 2001-05-09 1.9 T4 LYSOZYME MUTANT C54T/C97A/I58T
4WTV 2015-07-15 1.9 Crystal structure of the phosphatidylinositol 4-kinase IIbeta
248L 1998-03-18 1.9 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
1L67 1991-10-15 1.9 TOLERANCE OF T4 LYSOZYME TO MULTIPLE XAA (RIGHT ARROW) ALA SUBSTITUTIONS: A POLYALANINE ALPHA-HELIX CONTAINING TEN CONSECUTIVE ALANINES
1C6L 2000-10-04 1.9 T4 LYSOZYME MUTANT C54T/C97A/L99A/F153A IN THE PRESENCE OF 8 ATM ARGON
195L 1996-03-08 1.9 THERMODYNAMIC AND STRUCTURAL COMPENSATION IN 'SIZE-SWITCH' CORE-REPACKING VARIANTS OF T4 LYSOZYME
1QT6 1999-07-08 1.9 E11H Mutant of T4 Lysozyme
1LGU 2002-05-08 1.9 T4 Lysozyme Mutant L99A/M102Q
3L64 2010-01-19 1.9 T4 Lysozyme S44E/WT*
1C6I 2000-10-04 1.9 T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 8 ATM ARGON
1C6H 2000-10-04 1.9 T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 4 ATM XENON
230L 1998-01-14 1.9 T4 LYSOZYME MUTANT M6L
103L 1993-10-31 1.9 HOW AMINO-ACID INSERTIONS ARE ALLOWED IN AN ALPHA-HELIX OF T4 LYSOZYME
1L70 1991-10-15 1.9 MULTIPLE STABILIZING ALANINE REPLACEMENTS WITHIN ALPHA-HELIX 126-134 OF T4 LYSOZYME HAVE INDEPENDENT, ADDITIVE EFFECTS ON BOTH STRUCTURE AND STABILITY
1DYF 1993-10-31 1.9 DETERMINATION OF ALPHA-HELIX PROPENSITY WITHIN THE CONTEXT OF A FOLDED PROTEIN: SITES 44 AND 131 IN BACTERIOPHAGE T4 LYSOZYME
1DYA 1993-10-31 1.9 DETERMINATION OF ALPHA-HELIX PROPENSITY WITHIN THE CONTEXT OF A FOLDED PROTEIN: SITES 44 AND 131 IN BACTERIOPHAGE T4 LYSOZYME
1JTM 2002-03-20 1.9 Alternative Structures of a Sequence Extended T4 Lysozyme Show that the Highly Conserved Beta-Sheet has Weak Intrinsic Folding Propensity
222L 1998-03-18 1.9 GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS
1D9W 1999-11-17 1.91 BACTERIOPHAGE T4 LYSOZYME MUTANT
259L 1999-04-12 1.92 AN ADAPTABLE METAL-BINDING SITE ENGINEERED INTO T4 LYSOZYME
1CX7 1999-11-10 1.94 T4 LYSOZYME METHIONINE CORE MUTANT
2OU0 2007-08-07 1.94 1-methylpyrrole in complex with T4 Lysozyme L99A
191L 1995-09-15 1.95 A HELIX INITIATION SIGNAL IN T4 LYSOZYME IDENTIFIED BY POLYALANINE MUTAGENESIS
1L99 1993-10-31 1.95 PERTURBATION OF TRP 138 IN T4 LYSOZYME BY MUTATIONS AT GLN 105 USED TO CORRELATE CHANGES IN STRUCTURE, STABILITY, SOLVATION, AND SPECTROSCOPIC PROPERTIES
1OVH 2004-04-06 1.95 T4 Lysozyme Cavity Mutant L99A/M102Q Bound With 2-Chloro-6-Methyl-Aniline
200L 1996-03-08 1.95 THERMODYNAMIC AND STRUCTURAL COMPENSATION IN 'SIZE-SWITCH' CORE-REPACKING VARIANTS OF T4 LYSOZYME
3C7Y 2009-02-17 1.95 Mutant R96A OF T4 lysozyme in wildtype background at 298K
6IIH 2019-08-14 1.96 crystal structure of mitochondrial calcium uptake 2(MICU2)
215L 1996-12-23 1.96 PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME
1D3J 1999-10-08 1.97 N-TERMINAL DOMAIN CORE METHIONINE MUTATION
1KY0 2003-06-03 1.97 METHIONINE CORE MUTANT OF T4 LYSOZYME
1L0J 2003-06-03 1.98 METHIONINE CORE MUTANT OF T4 LYSOZYME
3C80 2009-02-17 1.99 T4 Lysozyme mutant R96Y at room temperature
1L85 1993-10-31 2.0 SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES
1LI6 2002-05-08 2.0 T4 lysozyme mutant L99A/M102Q bound by 5-methylpyrrole
141L 1994-01-31 2.0 ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME
1C6C 2000-10-04 2.0 T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 16 ATM ARGON
147L 1994-01-31 2.0 ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME
227L 1998-03-18 2.0 GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS
1C6T 2000-10-04 2.0 T4 LYSOZYME MUTANT C54T/C97A IN THE PRESENCE OF 8 ATM XENON
152L 1994-05-31 2.0 CONSERVATION OF SOLVENT-BINDING SITES IN 10 CRYSTAL FORMS OF T4 LYSOZYME
143L 1994-01-31 2.0 ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME
142L 1994-01-31 2.0 ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME
198L 1996-03-08 2.0 THERMODYNAMIC AND STRUCTURAL COMPENSATION IN 'SIZE-SWITCH' CORE-REPACKING VARIANTS OF T4 LYSOZYME
1L96 1993-10-31 2.0 STRUCTURE OF A HINGE-BENDING BACTERIOPHAGE T4 LYSOZYME MUTANT, ILE3-> PRO
1L95 1993-10-31 2.0 SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES
145L 1994-01-31 2.0 ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME
1C65 2000-10-04 2.0 T4 LYSOZYME MUTANT C54T/C97A/L121A IN THE PRESENCE OF 8 ATM XENON
1D3N 1999-09-30 2.0 METHIONINE CORE MUTATION
1QTZ 1999-07-08 2.0 D20C MUTANT OF T4 LYSOZYME
1L81 1993-04-15 2.0 DESIGN AND STRUCTURAL ANALYSIS OF ALTERNATIVE HYDROPHOBIC CORE PACKING ARRANGEMENTS IN BACTERIOPHAGE T4 LYSOZYME
1C60 2000-10-04 2.0 T4 LYSOZYME MUTANT C54T/C97A/F153A IN THE PRESENCE OF 8 ATM ARGON
1LYI 1993-10-31 2.0 DISSECTION OF HELIX CAPPING IN T4 LYSOZYME BY STRUCTURAL AND THERMODYNAMIC ANALYSIS OF SIX AMINO ACID SUBSTITUTIONS AT THR 59
5V83 2017-05-24 2.0 Structure of DCN1 bound to NAcM-HIT
1PQK 2003-10-07 2.0 Repacking of the Core of T4 Lysozyme by Automated Design
1OV7 2004-04-06 2.0 T4 Lysozyme Cavity Mutant L99A/M102Q Bound with 2-Allyl-6-Methyl-Phenol
1T8A 2004-08-17 2.0 USE OF SEQUENCE DUPLICATION TO ENGINEER A LIGAND-TRIGGERED LONG-DISTANCE MOLECULAR SWITCH IN T4 Lysozyme
1C6F 2000-10-04 2.0 T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 32 ATM ARGON
201L 1994-01-31 2.0 HOW AMINO-ACID INSERTIONS ARE ALLOWED IN AN ALPHA-HELIX OF T4 LYSOZYME
253L 1998-01-28 2.0 LYSOZYME
2HUK 2006-10-17 2.0 Crystal structure of T4 Lysozyme V131C synthetic dimer
1C63 2000-10-04 2.0 T4 LYSOZYME MUTANT C54T/C97A/L121A IN THE PRESENCE OF 8 ATM ARGON
1LI2 2002-05-08 2.0 T4 Lysozyme Mutant L99A/M102Q Bound by Phenol
1C64 2000-10-04 2.0 T4 LYSOZYME MUTANT C54T/C97A/L121A IN THE PRESENCE OF 8 ATM KRYPTON
190L 1995-09-15 2.0 A HELIX INITIATION SIGNAL IN T4 LYSOZYME IDENTIFIED BY POLYALANINE MUTAGENESIS
1LYD 1990-04-15 2.0 CRYSTAL STRUCTURE OF T4-LYSOZYME GENERATED FROM SYNTHETIC CODING DNA EXPRESSED IN ESCHERICHIA COLI
1TLA 1993-07-15 2.0 HYDROPHOBIC CORE REPACKING AND AROMATIC-AROMATIC INTERACTION IN THE THERMOSTABLE MUTANT OF T4 LYSOZYME SER 117 (RIGHT ARROW) PHE
3DMZ 2008-11-11 2.0 Hexafluorobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant
1OVJ 2004-04-06 2.0 T4 Lysozyme Cavity Mutant L99A/M102Q Bound with 3-Fluoro-2-Methyl_Aniline
1L97 1993-10-31 2.0 STRUCTURE OF A HINGE-BENDING BACTERIOPHAGE T4 LYSOZYME MUTANT, ILE3-> PRO
4YX7 2015-06-03 2.0 Complex of SpaO(SPOA1,2) and OrgB(APAR)::T4lysozyme fusion protein
1C61 2000-10-04 2.0 T4 LYSOZYME MUTANT C54T/C97A/F153A IN THE PRESENCE OF 8 ATM KRYPTON
1C6D 2000-10-04 2.0 T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 16 ATM KRYPTON
2L78 1993-04-15 2.0 DESIGN AND STRUCTURAL ANALYSIS OF ALTERNATIVE HYDROPHOBIC CORE PACKING ARRANGEMENTS IN BACTERIOPHAGE T4 LYSOZYME
1T6H 2004-10-26 2.01 Crystal Structure T4 Lysozyme incorporating an unnatural amino acid p-iodo-L-phenylalanine at position 153
2OE9 2007-01-30 2.01 High-pressure structure of pseudo-WT T4 Lysozyme
2OEA 2007-01-30 2.01 High-pressure structure of pseudo-WT T4 Lysozyme
1CX6 1999-12-15 2.01 T4 LYSOZYME SUBSTITUTED WITH SELENOMETHIONINE
1L0K 2003-06-03 2.02 METHIONINE CORE MUTANT OF T4 LYSOZYME
3HT9 2009-11-03 2.02 2-methoxyphenol in complex with T4 lysozyme L99A/M102Q
218L 1996-12-23 2.05 PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME
1D3F 1999-10-08 2.05 N-TERMINAL DOMAIN CORE METHIONINE MUTATION
1CUQ 1999-11-10 2.05 T4 LYSOZYME MUTANT V103M
1CU5 1999-11-10 2.05 T4 LYSOZYME MUTANT L91M
1KY1 2003-06-03 2.05 METHIONINE CORE MUTANT OF T4 LYSOZYME
1L77 1993-04-15 2.05 DESIGN AND STRUCTURAL ANALYSIS OF ALTERNATIVE HYDROPHOBIC CORE PACKING ARRANGEMENTS IN BACTERIOPHAGE T4 LYSOZYME
1D2Y 1999-10-08 2.06 N-TERMINAL DOMAIN CORE METHIONINE MUTATION
2OTZ 2007-08-07 2.07 N-methylaniline in complex with T4 Lysozyme L99A
3GUL 2009-08-25 2.07 T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--ethylbenzene binding
2OE7 2007-01-30 2.1 High-Pressure T4 Lysozyme
2B74 2005-11-08 2.1 T4 Lysozyme mutant L99A at 100 MPa
205L 1994-01-31 2.1 HOW AMINO-ACID INSERTIONS ARE ALLOWED IN AN ALPHA-HELIX OF T4 LYSOZYME
252L 1998-03-18 2.1 GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS
2B75 2005-11-08 2.1 T4 Lysozyme mutant L99A at 150 MPa
175L 1995-07-10 2.1 PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME
2Q9E 2007-06-26 2.1 Structure of spin-labeled T4 lysozyme mutant S44R1
1QT4 1999-07-08 2.1 T26Q MUTANT OF T4 LYSOZYME
1L82 1993-04-15 2.1 DESIGN AND STRUCTURAL ANALYSIS OF ALTERNATIVE HYDROPHOBIC CORE PACKING ARRANGEMENTS IN BACTERIOPHAGE T4 LYSOZYME
216L 1994-07-31 2.1 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
2OE4 2007-01-30 2.1 High Pressure Psuedo Wild Type T4 Lysozyme
1OV5 2004-04-06 2.1 T4 Lysozyme Cavity Mutant L99a/M102Q Bound With 2-Allylphenol
1LWK 2003-05-20 2.1 Multiple Methionine Substitutions are Tolerated in T4 Lysozyme and have Coupled Effects on Folding and Stability
1C6A 2000-10-04 2.1 T4 LYSOZYME MUTANT C54T/C97A/L133A IN THE PRESENCE OF 8 ATM KRYPTON
2B72 2005-11-08 2.1 T4 Lysozyme mutant L99A at 100 MPa
1C66 2000-10-04 2.1 T4 LYSOZYME MUTANT C54T/C97A/L121A/L133A IN THE PRESENCE OF 8 ATM ARGON
2B6T 2005-11-08 2.1 T4 Lysozyme mutant L99A at 200 MPa
1CV1 1999-11-10 2.1 T4 LYSOZYME MUTANT V111M
1DYC 1993-10-31 2.1 DETERMINATION OF ALPHA-HELIX PROPENSITY WITHIN THE CONTEXT OF A FOLDED PROTEIN: SITES 44 AND 131 IN BACTERIOPHAGE T4 LYSOZYME
1DYD 1993-10-31 2.1 DETERMINATION OF ALPHA-HELIX PROPENSITY WITHIN THE CONTEXT OF A FOLDED PROTEIN: SITES 44 AND 131 IN BACTERIOPHAGE T4 LYSOZYME
3G3V 2009-05-05 2.1 Crystal structure of spin labeled T4 Lysozyme (V131R1) at 291 K
1DYG 1993-10-31 2.1 DETERMINATION OF ALPHA-HELIX PROPENSITY WITHIN THE CONTEXT OF A FOLDED PROTEIN: SITES 44 AND 131 IN BACTERIOPHAGE T4 LYSOZYME
1OVK 2004-04-06 2.1 T4 Lysozyme Cavity Mutant L99A/M102Q Bound with N-Allyl-Aniline
197L 1996-03-08 2.1 THERMODYNAMIC AND STRUCTURAL COMPENSATION IN 'SIZE-SWITCH' CORE-REPACKING VARIANTS OF T4 LYSOZYME
144L 1994-01-31 2.1 ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME
140L 1994-01-31 2.1 ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME
1CU6 1999-11-17 2.1 T4 LYSOZYME MUTANT L91A
1C6M 2000-10-04 2.1 T4 LYSOZYME MUTANT C54T/C97A/L99A/F153A IN THE PRESENCE OF 8 ATM KRYPTON
1CTW 1999-11-10 2.1 T4 LYSOZYME MUTANT I78A
2B6X 2005-11-08 2.11 T4 Lysozyme mutant L99A at 200 MPa
1CU3 1999-11-10 2.12 T4 LYSOZYME MUTANT V87M
4S0W 2015-02-04 2.12 Wild type T4 lysozyme structure
1D3M 1999-09-30 2.12 METHIONINE CORE MUTATION
1CV0 1999-11-10 2.12 T4 LYSOZYME MUTANT F104M
213L 1996-12-23 2.13 PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME
1SSW 2004-10-19 2.13 Crystal structure of phage T4 lysozyme mutant Y24A/Y25A/T26A/I27A/C54T/C97A
2B73 2005-11-08 2.15 T4 Lysozyme mutant L99A at 100 MPa
1T8F 2004-10-19 2.15 Crystal structure of phage T4 lysozyme mutant R14A/K16A/I17A/K19A/T21A/E22A/C54T/C97A
3GUO 2009-08-25 2.16 T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--phenol binding
1KS3 2003-06-03 2.16 METHIONINE CORE MUTANT OF T4 LYSOZYME
176L 1995-07-10 2.2 PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME
150L 1994-04-30 2.2 CONSERVATION OF SOLVENT-BINDING SITES IN 10 CRYSTAL FORMS OF T4 LYSOZYME
151L 1994-04-30 2.2 CONSERVATION OF SOLVENT-BINDING SITES IN 10 CRYSTAL FORMS OF T4 LYSOZYME
5X93 2017-08-16 2.2 Human endothelin receptor type-B in complex with antagonist K-8794
6FFI 2018-03-07 2.2 Crystal Structure of mGluR5 in complex with MMPEP at 2.2 A
1C67 2000-10-04 2.2 T4 LYSOZYME MUTANT C54T/C97A/L121A/L133A IN THE PRESENCE OF 8 ATM KRYPTON
1C6B 2000-10-04 2.2 T4 LYSOZYME MUTANT C54T/C97A/L133A IN THE PRESENCE OF 8 ATM XENON
1C6N 2000-10-04 2.2 T4 LYSOZYME MUTANT C54T/C97A/L99A/F153A IN THE PRESENCE OF 8 ATM XENON
5TZR 2017-06-07 2.2 GPR40 in complex with partial agonist MK-8666
3VW7 2012-12-12 2.2 Crystal structure of human protease-activated receptor 1 (PAR1) bound with antagonist vorapaxar at 2.2 angstrom
2B6W 2005-11-08 2.2 T4 Lysozyme mutant L99A at 200 MPa
167L 1995-07-10 2.2 PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME
5VNQ 2017-07-26 2.2 Neutron crystallographic strucutre of perdeuterated T4 lysozyme cysteine-free pseudo-wild type at cryogenic temperature
1CU0 1999-11-10 2.2 T4 LYSOZYME MUTANT I78M
3GUM 2009-08-25 2.24 T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--p-xylene binding
5VBA 2017-07-05 2.27 Structure of EspG1 chaperone from the type VII (ESX-1) secretion system determined with the assistance of N-terminal T4 lysozyme fusion
1JTN 2002-03-20 2.3 Alternative Structures of a Sequence Extended T4 Lysozyme Show that the Highly Conserved Beta-Sheet Region has weak intrinsic Folding Propensity
3G3W 2009-05-05 2.3 Crystal structure of spin labeled T4 Lysozyme (T151R1) at 291 K
1C62 2000-10-04 2.3 T4 LYSOZYME MUTANT C54T/C97A/F153A IN THE PRESENCE OF 8 ATM XENON
196L 1996-03-08 2.3 THERMODYNAMIC AND STRUCTURAL COMPENSATION IN 'SIZE-SWITCH' CORE-REPACKING VARIANTS OF T4 LYSOZYME
4IAP 2013-07-31 2.3 Crystal structure of PH domain of Osh3 from Saccharomyces cerevisiae
1QTV 1999-07-08 2.3 T26E APO STRUCTURE OF T4 LYSOZYME
174L 1995-07-10 2.3 PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME
4PHU 2014-07-16 2.33 Crystal structure of Human GPR40 bound to allosteric agonist TAK-875
4YXA 2015-06-03 2.35 Complex of SpaO(SPOA1,2 SeMet) and OrgB(APAR)::T4lysozyme fusion protein
2HUM 2006-10-17 2.35 Crystal structure of T4 Lysozyme D72C synthetic dimer
2B6Z 2005-11-08 2.4 T4 Lysozyme mutant L99A at ambient pressure
5YQR 2018-01-31 2.4 Crystal structure of the PH-like domain of Lam6
2B6Y 2005-11-08 2.4 T4 Lysozyme mutant L99A at ambient pressure
1SSY 2004-10-19 2.4 Crystal structure of phage T4 lysozyme mutant G28A/I29A/G30A/C54T/C97A
2RH1 2007-10-30 2.4 High resolution crystal structure of human B2-adrenergic G protein-coupled receptor.
2QAR 2008-01-15 2.4 Structure of the 2TEL crystallization module fused to T4 lysozyme with a helical linker.
2B70 2005-11-08 2.4 T4 Lysozyme mutant L99A at ambient pressure
3SB9 2011-09-21 2.45 Cu-mediated Dimer of T4 Lysozyme R76H/R80H by Synthetic Symmetrization
3SB5 2011-09-21 2.46 Zn-mediated Trimer of T4 Lysozyme R125C/E128C by Synthetic Symmetrization
5D5A 2016-01-13 2.48 In meso in situ serial X-ray crystallography structure of the Beta2-adrenergic receptor at 100 K
1QS5 1999-07-02 2.5 THE INTRODUCTION OF STRAIN AND ITS EFFECTS ON THE STRUCTURE AND STABILITY OF T4 LYSOZYME
1QTD 1999-07-22 2.5 THE INTRODUCTION OF STRAIN AND ITS EFFECTS ON THE STRUCTURE AND STABILITY OF T4 LYSOZYME
1P5C 2004-05-04 2.5 Circular permutation of Helix A in T4 lysozyme
177L 1995-07-10 2.5 Protein flexibility and adaptability seen in 25 crystal forms of T4 LYSOZYME
262L 1999-05-24 2.5 STRUCTURAL CHARACTERISATION OF AN ENGINEERED TANDEM REPEAT CONTRASTS THE IMPORTANCE OF CONTEXT AND SEQUENCE IN PROTEIN FOLDING
1OYU 2003-07-08 2.5 Long-Distance conformational changes in a protein engineered by modulated sequence duplication
3ODU 2010-10-27 2.5 The 2.5 A structure of the CXCR4 chemokine receptor in complex with small molecule antagonist IT1t
1QTC 1999-07-22 2.5 THE INTRODUCTION OF STRAIN AND ITS EFFECTS ON THE STRUCTURE AND STABILITY OF T4 LYSOZYME
189L 1995-07-31 2.5 ENHANCEMENT OF PROTEIN STABILITY BY THE COMBINATION OF POINT MUTATIONS IN T4 LYSOZYME IS ADDITIVE
5EE7 2016-04-20 2.5 Crystal structure of the human glucagon receptor (GCGR) in complex with the antagonist MK-0893
6M9T 2018-12-05 2.5 Crystal structure of EP3 receptor bound to misoprostol-FA
231L 1998-01-14 2.5 T4 LYSOZYME MUTANT M106K
5GLI 2016-09-07 2.5 Human endothelin receptor type-B in the ligand-free form
171L 1995-07-10 2.5 PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME
1C68 2000-10-04 2.5 T4 LYSOZYME MUTANT C54T/C97A/L121A/L133A IN THE PRESENCE OF 8 ATM XENON
261L 1999-05-24 2.5 STRUCTURAL CHARACTERISATION OF AN ENGINEERED TANDEM REPEAT CONTRASTS THE IMPORTANCE OF CONTEXT AND SEQUENCE IN PROTEIN FOLDING
2QB0 2008-10-14 2.56 Structure of the 2TEL crystallization module fused to T4 lysozyme with an Ala-Gly-Pro linker.
4ARJ 2012-05-09 2.59 Crystal structure of a pesticin (translocation and receptor binding domain) from Y. pestis and T4-lysozyme chimera
149L 1994-04-30 2.6 CONSERVATION OF SOLVENT-BINDING SITES IN 10 CRYSTAL FORMS OF T4 LYSOZYME
5WF5 2018-02-21 2.6 Agonist bound human A2a adenosine receptor with D52N mutation at 2.60 A resolution
1JQU 2002-03-06 2.6 Are Carboxy Terminii of Helices Coded by the Local Sequence or by Tertiary Structure Contacts
4XES 2015-07-29 2.6 Structure of active-like neurotensin receptor
170L 1995-07-10 2.6 PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME
4EXM 2012-06-20 2.6 The crystal structure of an engineered phage lysin containing the binding domain of pesticin and the killing domain of T4-lysozyme
3EML 2008-10-14 2.6 The 2.6 A Crystal Structure of a Human A2A Adenosine Receptor bound to ZM241385.
5CGD 2015-08-12 2.6 Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane domain in complex with the negative allosteric modulator 3-chloro-5-[6-(5-fluoropyridin-2-yl)pyrimidin-4-yl]benzonitrile - (HTL14242)
251L 1998-03-18 2.6 THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT
5EWX 2016-03-30 2.6 Fusion protein of T4 lysozyme and B4 domain of protein A from staphylococcal aureus with chemical cross-linker EY-CBS
5DSG 2016-03-16 2.6 Structure of the M4 muscarinic acetylcholine receptor (M4-mT4L) bound to tiotropium
4OO9 2014-07-02 2.6 Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane domain in complex with the negative allosteric modulator mavoglurant
6FFH 2018-03-07 2.65 Crystal Structure of mGluR5 in complex with Fenobam at 2.65 A
3SB8 2011-09-21 2.65 Cu-mediated Dimer of T4 Lysozyme D61H/K65H by Synthetic Symmetrization
5JEA 2016-07-13 2.65 Structure of a cytoplasmic 11-subunit RNA exosome complex including Ski7, bound to RNA
5ZBQ 2018-04-25 2.7 The Crystal Structure of human neuropeptide Y Y1 receptor with UR-MK299
5CXV 2016-03-09 2.7 Structure of the human M1 muscarinic acetylcholine receptor bound to antagonist Tiotropium
6K1Q 2019-07-17 2.7 Human endothelin receptor type-B in complex with inverse agonist IRL2500
209L 1996-12-23 2.7 PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME
3SB6 2011-09-21 2.7 Cu-mediated Dimer of T4 Lysozyme D61H/K65H/R76H/R80H by Synthetic Symmetrization
6A9J 2019-03-20 2.7 Crystal structure of the PE-bound N-terminal domain of Atg2
3SB7 2011-09-21 2.7 Cu-mediated Trimer of T4 Lysozyme D61H/K65H/R76H/R80H by Synthetic Symmetrization
1T97 2004-08-17 2.7 Use of sequence duplication to engineer a ligand-triggered long-distance molecular switch in T4 Lysozyme
5X7D 2017-08-16 2.7 Structure of beta2 adrenoceptor bound to carazolol and an intracellular allosteric antagonist
6J20 2019-03-06 2.7 Crystal structure of the human NK1 substance P receptor
5VEW 2017-05-24 2.7 Structure of the human GLP-1 receptor complex with PF-06372222
178L 1995-07-10 2.71 Protein flexibility and adaptability seen in 25 crystal forms of T4 LYSOZYME
3QAK 2011-03-09 2.71 Agonist bound structure of the human adenosine A2a receptor
6D27 2018-10-03 2.74 Crystal structure of the prostaglandin D2 receptor CRTH2 with CAY10471
3SBA 2011-09-21 2.75 Zn-mediated Hexamer of T4 Lysozyme R76H/R80H by Synthetic Symmetrization
5KW2 2018-05-02 2.76 The extra-helical binding site of GPR40 and the structural basis for allosteric agonism and incretin stimulation
4LDE 2013-09-25 2.79 Structure of beta2 adrenoceptor bound to BI167107 and an engineered nanobody
5EUT 2015-12-23 2.8 Crystal structure of phosphatidyl inositol 4-kinase II alpha in the apo state
5GLH 2016-09-07 2.8 Human endothelin receptor type-B in complex with ET-1
5NDD 2017-05-03 2.8 Crystal structure of a thermostabilised human protease-activated receptor-2 (PAR2) in complex with AZ8838 at 2.8 angstrom resolution
4DKL 2012-03-21 2.8 Crystal structure of the mu-opioid receptor bound to a morphinan antagonist
3V2Y 2012-02-15 2.8 Crystal Structure of a Lipid G protein-Coupled Receptor at 2.80A
104L 1993-10-31 2.8 HOW AMINO-ACID INSERTIONS ARE ALLOWED IN AN ALPHA-HELIX OF T4 LYSOZYME
4GRV 2012-10-17 2.8 The crystal structure of the neurotensin receptor NTS1 in complex with neurotensin (8-13)
6D26 2018-10-03 2.8 Crystal structure of the prostaglandin D2 receptor CRTH2 with fevipiprant
3D4S 2008-06-17 2.8 Cholesterol bound form of human beta2 adrenergic receptor.
5T1A 2016-12-14 2.81 Structure of CC Chemokine Receptor 2 with Orthosteric and Allosteric Antagonists
3NY8 2010-08-11 2.84 Crystal structure of the human beta2 adrenergic receptor in complex with the inverse agonist ICI 118,551
3NY9 2010-08-11 2.84 Crystal structure of the human beta2 adrenergic receptor in complex with a novel inverse agonist
6CM4 2018-03-14 2.87 Structure of the D2 Dopamine Receptor Bound to the Atypical Antipsychotic Drug Risperidone
3PBL 2010-11-03 2.89 Structure of the human dopamine D3 receptor in complex with eticlopride
4DJH 2012-03-21 2.9 Structure of the human kappa opioid receptor in complex with JDTic
3OE0 2010-10-27 2.9 Crystal structure of the CXCR4 chemokine receptor in complex with a cyclic peptide antagonist CVX15
168L 1995-07-10 2.9 PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME
4N9N 2014-12-03 2.9 Crystal Structure of Saccharomyces cerevisiae Upc2 Transcription Factor fused with T4 Lysozyme
5WF6 2018-02-21 2.9 Agonist bound human A2a adenosine receptor with S91A mutation at 2.90 A resolution
4XEE 2015-07-29 2.9 Structure of active-like neurotensin receptor
6QAJ 2019-07-24 2.9 Structure of the tripartite motif of KAP1/TRIM28
5ZKQ 2018-06-20 2.9 Crystal structure of the human platelet-activating factor receptor in complex with ABT-491
6MXT 2018-11-14 2.96 Crystal structure of human beta2 adrenergic receptor bound to salmeterol and Nb71
4K5Y 2013-07-17 2.98 Crystal structure of human corticotropin-releasing factor receptor 1 (CRF1R) in complex with the antagonist CP-376395
2B7X 2006-08-01 3.0 Sequential reorganization of beta-sheet topology by insertion of a single strand
3JR6 2009-10-20 3.0 Sequential reorganization of beta-sheet topology by insertion of a single strand
3UON 2012-02-01 3.0 Structure of the human M2 muscarinic acetylcholine receptor bound to an antagonist
5YQZ 2018-01-17 3.0 Structure of the glucagon receptor in complex with a glucagon analogue
5ZBH 2018-04-25 3.0 The Crystal Structure of Human Neuropeptide Y Y1 Receptor with BMS-193885
169L 1995-07-10 3.0 PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME
5XEZ 2017-05-24 3.0 Structure of the Full-length glucagon class B G protein-coupled receptor
5VEX 2017-05-17 3.0 Structure of the human GLP-1 receptor complex with NNC0640
5W0P 2017-08-09 3.01 Crystal structure of rhodopsin bound to visual arrestin determined by X-ray free electron laser
3OE8 2010-10-27 3.1 Crystal structure of the CXCR4 chemokine receptor in complex with a small molecule antagonist IT1t in P1 spacegroup
3OE9 2010-10-27 3.1 Crystal structure of the chemokine CXCR4 receptor in complex with a small molecule antagonist IT1t in P1 spacegroup
5CGC 2015-08-12 3.1 Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane domain in complex with the negative allosteric modulator 3-chloro-4-fluoro-5-[6-(1H-pyrazol-1-yl)pyrimidin-4-yl]benzonitrile
5ZHP 2018-11-28 3.1 M3 muscarinic acetylcholine receptor in complex with a selective antagonist
4RWS 2015-02-11 3.1 Crystal structure of CXCR4 and viral chemokine antagonist vMIP-II complex (PSI Community Target)
3RZE 2011-06-15 3.1 Structure of the human histamine H1 receptor in complex with doxepin
4LDL 2013-09-25 3.1 Structure of beta2 adrenoceptor bound to hydroxybenzylisoproterenol and an engineered nanobody
3NYA 2010-08-11 3.16 Crystal structure of the human beta2 adrenergic receptor in complex with the neutral antagonist alprenolol
5XF1 2017-05-24 3.19 Structure of the Full-length glucagon class B G protein-coupled receptor
6J21 2019-03-06 3.2 Crystal structure of the human NK1 substance P receptor
5XSZ 2017-08-16 3.2 Crystal structure of zebrafish lysophosphatidic acid receptor LPA6
5D6L 2016-08-17 3.2 beta2AR-T4L - CIM
3OE6 2010-10-27 3.2 Crystal structure of the CXCR4 chemokine receptor in complex with a small molecule antagonist IT1t in I222 spacegroup
3SN6 2011-07-20 3.2 Crystal structure of the beta2 adrenergic receptor-Gs protein complex
5JQH 2016-07-13 3.2 Structure of beta2 adrenoceptor bound to carazolol and inactive-state stabilizing nanobody, Nb60
4LDO 2013-09-25 3.2 Structure of beta2 adrenoceptor bound to adrenaline and an engineered nanobody
6A9E 2019-03-20 3.2 Crystal structure of the N-terminal domain of Atg2
4TN3 2014-07-16 3.2 Structure of the BBox-Coiled-coil region of Rhesus Trim5alpha
5TZY 2017-06-07 3.22 GPR40 in complex with AgoPAM AP8 and partial agonist MK-8666
5T04 2016-12-21 3.3 STRUCTURE OF CONSTITUTIVELY ACTIVE NEUROTENSIN RECEPTOR
4ZWJ 2015-07-29 3.3 Crystal structure of rhodopsin bound to arrestin by femtosecond X-ray laser
4QKX 2014-07-23 3.3 Structure of beta2 adrenoceptor bound to a covalent agonist and an engineered nanobody
3V2W 2012-02-15 3.35 Crystal Structure of a Lipid G protein-Coupled Receptor at 3.35A
4DAJ 2012-02-22 3.4 Structure of the M3 Muscarinic Acetylcholine Receptor
4EJ4 2012-05-16 3.4 Structure of the delta opioid receptor bound to naltrindole
5B2G 2016-10-05 3.5 Crystal structure of human claudin-4 in complex with C-terminal fragment of Clostridium perfringens enterotoxin
3P0G 2011-01-19 3.5 Structure of a nanobody-stabilized active state of the beta2 adrenoceptor
3PDS 2011-01-12 3.5 Irreversible Agonist-Beta2 Adrenoceptor Complex
4W8F 2014-11-12 3.54 Crystal structure of the dynein motor domain in the AMPPNP-bound state
4U14 2014-11-26 3.57 Structure of the M3 muscarinic acetylcholine receptor bound to the antagonist tiotropium crystallized with disulfide-stabilized T4 lysozyme (dsT4L)
5NDZ 2017-05-03 3.6 Crystal structure of a thermostabilised human protease-activated receptor-2 (PAR2) in complex with AZ3451 at 3.6 angstrom resolution
5XPR 2017-08-16 3.6 Human endothelin receptor type-B in complex with antagonist bosentan
5D5B 2016-01-13 3.8 In meso X-ray crystallography structure of the Beta2-adrenergic receptor at 100 K
4GBR 2012-10-24 3.99 N-Terminal T4 Lysozyme Fusion Facilitates Crystallization of a G Protein Coupled Receptor
4HTT 2013-05-01 6.8 Crystal Structure of Twin Arginine Translocase Receptor- TatC in DDM
5DGY 2016-03-23 7.7 Crystal structure of rhodopsin bound to visual arrestin

Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
100.0 Endolysin P00720 ENLYS_BPT4