The formation of a native-like structure containing eight conserved hydrophobic residues is rate limiting in two-state protein folding of ACBP.

Abstract

The acyl-coenzyme A-binding proteins (ACBPs) contain 26 highly conserved sequence positions. The majority of these have been mutated in the bovine protein, and their influence on the rate of two-state folding and unfolding has been measured. The results identify eight sequence positions, out of 24 probed, that are critical for fast productive folding. The residues are all hydrophobic and located in the interface between the N- and C-terminal helices. The results suggest that one specific site dominated by conserved hydrophobic residues forms the structure of the productive rate-determining folding step and that a sequential framework model can describe the protein folding reaction. Study holds ProTherm entries: 6983, 6984, 6985, 6986, 6987, 6988, 6989, 6990, 6991, 6992, 6993, 6994, 6995, 6996, 6997, 6998, 6999, 7000, 7001, 7002, 7003, 7004, 7005, 7006, 7007, 7008, 7009, 7010, 7011, 7012, 7013 Extra Details: two-state folding; hydrophobic; rate-determining folding step;,sequential framework model; protein folding

Submission Details

ID: DoDZt8HY3

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:32 p.m.

Version: 1

Publication Details
Kragelund BB;Osmark P;Neergaard TB;Schiødt J;Kristiansen K;Knudsen J;Poulsen FM,Nat. Struct. Biol. (1999) The formation of a native-like structure containing eight conserved hydrophobic residues is rate limiting in two-state protein folding of ACBP. PMID:10360367
Additional Information

Study Summary

Number of data points 92
Proteins Acyl-CoA-binding protein ; Acyl-CoA-binding protein
Unique complexes 31
Assays/Quantities/Protocols Experimental Assay: m ; Experimental Assay: dG_H2O ; Derived Quantity: ddG_H2O
Libraries Mutations for sequence SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
100.0 Acyl-CoA-binding protein P07107 ACBP_BOVIN
95.4 Acyl-CoA-binding protein P82934 ACBP_CHAVI
93.1 Acyl-CoA-binding protein P07108 ACBP_HUMAN
92.0 Acyl-CoA-binding protein P12026 ACBP_PIG