A calorimetric study of thermally induced conformational transitions of ribonuclease A and certain of its derivatives.


Abstract

Study holds ProTherm entries: 7334, 7335, 7336, 7337, 7338, 7339, 7340, 7341, 7342, 7343, 7344, 7345, 7346, 7347, 7348, 7349, 7350, 7351, 7352, 7353 Extra Details: conformational transition; cooperativity; two-state process;,calorimatric measurement

Submission Details

ID: DLsq5XWV4

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:33 p.m.

Version: 1

Publication Details
Tsong TY;Hearn RP;Wrathall DP;Sturtevant JM,Biochemistry (1970) A calorimetric study of thermally induced conformational transitions of ribonuclease A and certain of its derivatives. PMID:5465355
Additional Information

Number of data points 60
Proteins Ribonuclease pancreatic ; Ribonuclease pancreatic
Unique complexes 1
Assays/Quantities/Protocols Experimental Assay: dHcal ionic:NaCl: 0.2 N, pH:1.05, buffers:HCl: - ; Experimental Assay: Tm ionic:NaCl: 0.2 N, pH:1.05, buffers:HCl: - ; Experimental Assay: dHcal ionic:HCl: , pH:0.36, buffers:HCl: - ; Experimental Assay: Tm ionic:HCl: , pH:0.36, buffers:HCl: - ; Experimental Assay: dCp ionic:NaCl: 0.2 N, buffers:None: -, pH:7.8 ; Experimental Assay: dHcal ionic:NaCl: 0.2 N, buffers:None: -, pH:7.8 ; Experimental Assay: Tm ionic:NaCl: 0.2 N, buffers:None: -, pH:7.8 ; Experimental Assay: dHvH ionic:NaCl: 0.2 N, buffers:None: -, pH:7.8 ; Experimental Assay: dCp ionic:NaCl: 0.2 N, buffers:None: -, pH:7.0 ; Experimental Assay: dHcal ionic:NaCl: 0.2 N, buffers:None: -, pH:7.0 ; Experimental Assay: Tm ionic:NaCl: 0.2 N, buffers:None: -, pH:7.0 ; Experimental Assay: dHvH ionic:NaCl: 0.2 N, buffers:None: -, pH:7.0 ; Experimental Assay: dCp pH:6.23, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: dHcal pH:6.23, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: Tm pH:6.23, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: dHvH pH:6.23, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: dCp pH:5.0, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: dHcal pH:5.0, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: Tm pH:5.0, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: dHvH pH:5.0, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: dCp ionic:: , buffers:acetate: 0.2 N, pH:4.04 ; Experimental Assay: dHcal ionic:: , buffers:acetate: 0.2 N, pH:4.04 ; Experimental Assay: Tm ionic:: , buffers:acetate: 0.2 N, pH:4.04 ; Experimental Assay: dHvH ionic:: , buffers:acetate: 0.2 N, pH:4.04 ; Experimental Assay: dCp ionic:: , pH:3.28, buffers:glycine: 0.2 N ; Experimental Assay: dHcal ionic:: , buffers:glycine: 0.2 N, pH:3.28 ; Experimental Assay: Tm ionic:: , pH:3.28, buffers:glycine: 0.2 N ; Experimental Assay: dHvH ionic:: , pH:3.28, buffers:glycine: 0.2 N ; Experimental Assay: dCp pH:2.8, ionic:: , buffers:glycine: 0.2 N ; Experimental Assay: dHcal pH:2.8, ionic:: , buffers:glycine: 0.2 N ; Experimental Assay: Tm pH:2.8, ionic:: , buffers:glycine: 0.2 N ; Experimental Assay: dHvH ionic:: , pH:2.8, buffers:glycine: 0.2 N ; Experimental Assay: dCp pH:2.02, ionic:: , buffers:glycine: 0.2 N ; Experimental Assay: dHcal pH:2.02, ionic:: , buffers:glycine: 0.2 N ; Experimental Assay: Tm pH:2.02, ionic:: , buffers:glycine: 0.2 N ; Experimental Assay: dHvH pH:2.02, ionic:: , buffers:glycine: 0.2 N ; Experimental Assay: dCp ionic:NaCl: 0.1 N, pH:1.05, buffers:glycine: 0.2 N ; Experimental Assay: dHcal ionic:NaCl: 0.1 N, pH:1.05, buffers:glycine: 0.2 N ; Experimental Assay: Tm ionic:NaCl: 0.1 N, pH:1.05, buffers:glycine: 0.2 N ; Experimental Assay: dHvH ionic:NaCl: 0.1 N, pH:1.05, buffers:glycine: 0.2 N ; Experimental Assay: dCp ionic:HCl: , buffers:glycine: 0.2 N, pH:0.36 ; Experimental Assay: dHcal ionic:HCl: , buffers:glycine: 0.2 N, pH:0.36 ; Experimental Assay: Tm ionic:HCl: , buffers:glycine: 0.2 N, pH:0.36 ; Experimental Assay: dHvH ionic:HCl: , buffers:glycine: 0.2 N, pH:0.36
Libraries Mutations for sequence KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
Sequence Assay Result Units