A calorimetric study of thermally induced conformational transitions of ribonuclease A and certain of its derivatives.


Abstract

Study holds ProTherm entries: 7334, 7335, 7336, 7337, 7338, 7339, 7340, 7341, 7342, 7343, 7344, 7345, 7346, 7347, 7348, 7349, 7350, 7351, 7352, 7353 Extra Details: conformational transition; cooperativity; two-state process;,calorimatric measurement

Submission Details

ID: DLsq5XWV4

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:33 p.m.

Version: 1

Publication Details
Tsong TY;Hearn RP;Wrathall DP;Sturtevant JM,Biochemistry (1970) A calorimetric study of thermally induced conformational transitions of ribonuclease A and certain of its derivatives. PMID:5465355
Additional Information

Study Summary

Number of data points 60
Proteins Ribonuclease pancreatic ; Ribonuclease pancreatic
Unique complexes 1
Assays/Quantities/Protocols Experimental Assay: dHcal ionic:NaCl: 0.2 N, pH:1.05, buffers:HCl: - ; Experimental Assay: Tm ionic:NaCl: 0.2 N, pH:1.05, buffers:HCl: - ; Experimental Assay: dHcal ionic:HCl: , pH:0.36, buffers:HCl: - ; Experimental Assay: Tm ionic:HCl: , pH:0.36, buffers:HCl: - ; Experimental Assay: dCp ionic:NaCl: 0.2 N, buffers:None: -, pH:7.8 ; Experimental Assay: dHcal ionic:NaCl: 0.2 N, buffers:None: -, pH:7.8 ; Experimental Assay: Tm ionic:NaCl: 0.2 N, buffers:None: -, pH:7.8 ; Experimental Assay: dHvH ionic:NaCl: 0.2 N, buffers:None: -, pH:7.8 ; Experimental Assay: dCp ionic:NaCl: 0.2 N, buffers:None: -, pH:7.0 ; Experimental Assay: dHcal ionic:NaCl: 0.2 N, buffers:None: -, pH:7.0 ; Experimental Assay: Tm ionic:NaCl: 0.2 N, buffers:None: -, pH:7.0 ; Experimental Assay: dHvH ionic:NaCl: 0.2 N, buffers:None: -, pH:7.0 ; Experimental Assay: dCp pH:6.23, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: dHcal pH:6.23, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: Tm pH:6.23, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: dHvH pH:6.23, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: dCp pH:5.0, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: dHcal pH:5.0, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: Tm pH:5.0, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: dHvH pH:5.0, ionic:: , buffers:acetate: 0.2 N ; Experimental Assay: dCp ionic:: , buffers:acetate: 0.2 N, pH:4.04 ; Experimental Assay: dHcal ionic:: , buffers:acetate: 0.2 N, pH:4.04 ; Experimental Assay: Tm ionic:: , buffers:acetate: 0.2 N, pH:4.04 ; Experimental Assay: dHvH ionic:: , buffers:acetate: 0.2 N, pH:4.04 ; Experimental Assay: dCp ionic:: , pH:3.28, buffers:glycine: 0.2 N ; Experimental Assay: dHcal ionic:: , buffers:glycine: 0.2 N, pH:3.28 ; Experimental Assay: Tm ionic:: , pH:3.28, buffers:glycine: 0.2 N ; Experimental Assay: dHvH ionic:: , pH:3.28, buffers:glycine: 0.2 N ; Experimental Assay: dCp pH:2.8, ionic:: , buffers:glycine: 0.2 N ; Experimental Assay: dHcal pH:2.8, ionic:: , buffers:glycine: 0.2 N ; Experimental Assay: Tm pH:2.8, ionic:: , buffers:glycine: 0.2 N ; Experimental Assay: dHvH ionic:: , pH:2.8, buffers:glycine: 0.2 N ; Experimental Assay: dCp pH:2.02, ionic:: , buffers:glycine: 0.2 N ; Experimental Assay: dHcal pH:2.02, ionic:: , buffers:glycine: 0.2 N ; Experimental Assay: Tm pH:2.02, ionic:: , buffers:glycine: 0.2 N ; Experimental Assay: dHvH pH:2.02, ionic:: , buffers:glycine: 0.2 N ; Experimental Assay: dCp ionic:NaCl: 0.1 N, pH:1.05, buffers:glycine: 0.2 N ; Experimental Assay: dHcal ionic:NaCl: 0.1 N, pH:1.05, buffers:glycine: 0.2 N ; Experimental Assay: Tm ionic:NaCl: 0.1 N, pH:1.05, buffers:glycine: 0.2 N ; Experimental Assay: dHvH ionic:NaCl: 0.1 N, pH:1.05, buffers:glycine: 0.2 N ; Experimental Assay: dCp ionic:HCl: , buffers:glycine: 0.2 N, pH:0.36 ; Experimental Assay: dHcal ionic:HCl: , buffers:glycine: 0.2 N, pH:0.36 ; Experimental Assay: Tm ionic:HCl: , buffers:glycine: 0.2 N, pH:0.36 ; Experimental Assay: dHvH ionic:HCl: , buffers:glycine: 0.2 N, pH:0.36
Libraries Mutations for sequence KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant PDB Entries

Structure ID Release Date Resolution Structure Title
6QMN 2019-02-07T00:00:00+0000 2.31 Crystal structure of a Ribonuclease A-Onconase chimera
1A2W 1998-01-12T00:00:00+0000 2.1 CRYSTAL STRUCTURE OF A 3D DOMAIN-SWAPPED DIMER OF BOVINE PANCREATIC RIBONUCLEASE A
1A5P 1998-02-17T00:00:00+0000 1.6 C[40,95]A VARIANT OF BOVINE PANCREATIC RIBONUCLEASE A
1A5Q 1998-02-17T00:00:00+0000 2.3 P93A VARIANT OF BOVINE PANCREATIC RIBONUCLEASE A
1AFK 1997-03-08T00:00:00+0000 1.7 CRYSTAL STRUCTURE OF RIBONUCLEASE A IN COMPLEX WITH 5'-DIPHOSPHOADENOSINE-3'-PHOSPHATE
1AFL 1997-03-08T00:00:00+0000 1.7 RIBONUCLEASE A IN COMPLEX WITH 5'-DIPHOSPHOADENOSINE 2'-PHOSPHATE AT 1.7 ANGSTROM RESOLUTION
1AFU 1997-03-14T00:00:00+0000 2.0 STRUCTURE OF RIBONUCLEASE A AT 2.0 ANGSTROMS FROM MONOCLINIC CRYSTALS
1AQP 1997-07-31T00:00:00+0000 2.0 RIBONUCLEASE A COPPER COMPLEX
1B6V 1999-01-18T00:00:00+0000 2.0 CRYSTAL STRUCTURE OF A HYBRID BETWEEN RIBONUCLEASE A AND BOVINE SEMINAL RIBONUCLEASE
1BEL 1995-12-21T00:00:00+0000 1.6 HYDROLASE PHOSPHORIC DIESTER, RNA

Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
100.0 Ribonuclease pancreatic P61824 RNAS1_BISBI
100.0 Ribonuclease pancreatic P61823 RNAS1_BOVIN
96.8 Ribonuclease pancreatic P67926 RNAS1_CAPHI
96.8 Ribonuclease pancreatic P67927 RNAS1_SHEEP
95.2 Ribonuclease pancreatic P00657 RNAS1_BUBBU
96.0 Ribonuclease pancreatic P07847 RNAS1_AEPME
93.5 Ribonuclease pancreatic P07848 RNAS1_EUDTH
95.2 Ribonuclease pancreatic P00660 RNAS1_CONTA
92.7 Ribonuclease pancreatic P00668 RNAS1_ANTAM
90.3 Ribonuclease pancreatic P00662 RNAS1_GIRCA
96.0 Ribonuclease pancreatic Q29606 RNAS1_ORYLE