Acid-induced unfolding mechanism of recombinant human endostatin.

Abstract

Endostatin is a potent angiogenesis inhibitor. The structure of endostatin is unique in that its secondary structure is mainly irregular loops and beta-sheets and contains only a small fraction of alpha-helices with two pairs of disulfide bonds in a nested pattern. We choose human endostatin as a model system to study the folding mechanism of this kind. Nuclear magnetic resonance (NMR), tryptophan emission fluorescence, and circular dichroism (CD) were used to monitor the unfolding process of endostatin upon acid titration. Urea-induced unfolding was used to measure the stability of endostatin under different conditions. Our results show that endostatin is very acid-resistant; some native structure still remains even at pH 2 as evidenced by (1)H NMR. Trifluoroethanol (TFE) destabilizes native endostatin, while it makes endostatin even more acid-resistant in the low pH region. Stability measurement of endostatin suggests that endostatin is still in native structure at pH 3.5 despite the decreased stability. Acid-induced unfolding of endostatin is reversible, although it requires a long time to reach equilibrium below pH 3. Surprisingly, the alpha-helical content of endostatin is increased when it is unfolded at pH 1.6, and the alpha-helical content of the polypeptide chain of unfolded endostatin increases linearly with TFE concentration in the range of 0-30%. This observation indicates that the polypeptide chain of unfolded endostatin has an intrinsic alpha-helical propensity. Our discoveries may provide clues for refolding endostatin more efficiently. The acid-resistance property of endostatin may have biological significance in that it cannot be easily digested by proteases in an acidic environment such as in a lysosome in the cell. Study holds ProTherm entries: 16905, 16906, 16907, 16908 Extra Details: angiogenesis inhibitor; irregular loops; disulfide bonds; acid-resistant

Submission Details

ID: CK84V5tF3

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:48 p.m.

Version: 1

Publication Details
Li B;Wu X;Zhou H;Chen Q;Luo Y,Biochemistry (2004) Acid-induced unfolding mechanism of recombinant human endostatin. PMID:14992592
Additional Information

Study Summary

Number of data points 8
Proteins Collagen alpha-1(XVIII) chain ; Collagen alpha-1(XVIII) chain
Unique complexes 1
Assays/Quantities/Protocols Experimental Assay: Cm pH:3.5, buffers:sodium acetate: 4 mM, details:Additives TFE (5 %), ; Experimental Assay: m pH:3.5, buffers:sodium acetate: 4 mM, details:Additives TFE (5 %), ; Experimental Assay: Cm details:Additives , pH:3.5, buffers:sodium acetate: 4 mM ; Experimental Assay: m details:Additives , pH:3.5, buffers:sodium acetate: 4 mM ; Experimental Assay: Cm buffers:Tris-HCl: 5 mM, pH:7.4, details:Additives TFE (5 %), ; Experimental Assay: m buffers:Tris-HCl: 5 mM, pH:7.4, details:Additives TFE (5 %), ; Experimental Assay: Cm buffers:Tris-HCl: 5 mM, details:Additives , pH:7.4 ; Experimental Assay: m buffers:Tris-HCl: 5 mM, details:Additives , pH:7.4
Libraries Mutations for sequence HSHRDFQPVLHLVALNAPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSF

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
100.0 Collagen alpha-1(XVIII) chain P39060 COIA1_HUMAN