The conformational stability and flexibility of insulin containing a cross-link between the alpha-amino group of the A-chain to the epsilon-amino group of Lys29 of the B-chain was examined. The cross-link varied in length from 2 to 12 carbon atoms. The conformational stability was determined by guanidine hydrochloride-induced equilibrium denaturation and flexibility was assessed by H2O/D2O amide exchange. The cross-link has substantial effects on both conformational stability and flexibility which depend on its length. In general, the addition of a cross-link enhances conformational stability and decreases flexibility. The optimal length for enhanced stability and decreased flexibility was the 6-carbon link. For the 6-carbon link the Gibbs free energy of unfolding was 8.0 kcal/mol compared to 4.5 kcal/mol for insulin, and the amide exchange rate decreased by at least 3-fold. A very short cross-link (i.e. the 2-carbon link) caused conformational strain that was detectable by a lack of stabilization in the Gibbs free energy of unfolding and enhancement in the amide exchange rate compared to insulin. The effect of the cross-link length on insulin hydrodynamic properties is discussed relative to previously obtained receptor binding results. Study holds ProTherm entries: 5157 Extra Details: additive : EDTA(1 mM), conformational stability; flexibility; H2O/D2O amide exchange;,hydrodynamic properties; receptor binding
ID: 8t5hLSwC
Submitter: Connie Wang
Submission Date: April 24, 2018, 8:28 p.m.
Version: 1
Number of data points | 2 |
Proteins | Insulin ; Insulin |
Unique complexes | 1 |
Assays/Quantities/Protocols | Experimental Assay: Cm ; Experimental Assay: dG_H2O |
Libraries | Mutations for sequence A:GIVEQCCTSICSLYQLENYCN/B:FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Colors: | D | E | R | H | K | S | T | N | Q | A | V | I | L | M | F | Y | W | C | G | P |
---|
Percent Identity | Matching Chains | Protein | Accession | Entry Name |
---|---|---|---|---|
200.0 | A,B | Insulin | P01315 | INS_PIG |
200.0 | A,B | Insulin | P67973 | INS_BALPH |
200.0 | A,B | Insulin | P01321 | INS_CANLF |
200.0 | A,B | Insulin | P30407 | INS_CHLAE |
200.0 | A,B | Insulin | Q6YK33 | INS_GORGO |
200.0 | A,B | Insulin | P01308 | INS_HUMAN |
196.7 | A,B | Insulin | Q91XI3 | INS_ICTTR |
200.0 | A,B | Insulin | P30406 | INS_MACFA |
200.0 | A,B | Insulin | P30410 | INS_PANTR |
200.0 | A,B | Insulin | P67974 | INS_PHYMC |
200.0 | A,B | Insulin | Q8HXV2 | INS_PONPY |
196.7 | A,B | Insulin | P01311 | INS_RABIT |
95.2 | A | Insulin | P01325 | INS1_MOUSE |
95.2 | A | Insulin | P01322 | INS1_RAT |
191.60000000000002 | A,B | Insulin | P01326 | INS2_MOUSE |
191.60000000000002 | A,B | Insulin | P01323 | INS2_RAT |
188.5 | A,B | Insulin | P01324 | INS_ACOCA |
191.9 | A,B | Insulin | P01313 | INS_CRILO |
195.2 | A,B | Insulin | P01310 | INS_HORSE |
195.2 | A,B | Insulin | Q62587 | INS_PSAOB |
190.5 | A,B | Insulin | P01316 | INS_ELEMA |
190.5 | A,B | Insulin | P01317 | INS_BOVIN |
187.2 | A,B | Insulin | P01320 | INS_CAMDR |
90.5 | A | Insulin | P01327 | INS_CHICH |
190.5 | A,B | Insulin | P01314 | INS_BALBO |
190.5 | A,B | Insulin | P18109 | INS_DIDVI |
100.0 | B | Insulin | P01319 | INS_CAPHI |
100.0 | B | Insulin | P06306 | INS_FELCA |
100.0 | B | Insulin | P01318 | INS_SHEEP |
100.0 | B | Insulin | F8WCM5 | INSR2_HUMAN |
96.6 | B | Insulin | P51463 | INS_SELRF |
96.4 | B | Insulin | P67970 | INS_CHICK |
96.4 | B | Insulin | P67968 | INS_MELGA |
96.4 | B | Insulin | P67969 | INS_STRCA |
96.4 | B | Insulin | P69047 | INS_TRADO |
96.4 | B | Insulin | P69048 | INS_TRASC |
93.1 | B | Insulin | P67972 | INS_AOTTR |
93.1 | B | Insulin | P67971 | INS_SAISC |
96.3 | B | Insulin | P01333 | INS_ANAPL |
96.3 | B | Insulin | P68245 | INS_ANSAN |
96.3 | B | Insulin | P68243 | INS_CAIMO |
92.9 | B | Insulin | P12706 | INS1_XENLA |
93.3 | B | Insulin | P83770 | INSL_VIGUN |
100.0 | B | Insulin | P81423 | INS_ACIGU |
96.6 | B | Insulin | P21563 | INS_RODSP |
96.2 | B | Insulin | C0HJI8 | INS2_HUSDA |
92.6 | B | Insulin | P12707 | INS2_XENLA |
92.6 | B | Insulin | P01340 | INS_KATPE |
92.3 | B | Insulin | P04667 | INS_ONCKE |
92.3 | B | Insulin | P09477 | INS_PLAFE |
92.3 | B | Insulin | Q9W7R2 | INS_VERMO |
92.3 | B | Insulin | P09476 | INS_ATRSP |
92.3 | B | Insulin | C0HJI3 | INS2_KATPE |
92.6 | B | Insulin | C0HJI7 | INS1_HUSDA |
91.7 | B | Insulin | P68988 | INS_LAMFL |
91.7 | B | Insulin | P68987 | INS_PETMA |
91.3 | B | Insulin | P01338 | INS2_BATSP |