Spectral studies on the denaturation of myoglobin.

Abstract

Study holds ProTherm entries: 10124, 10125 Extra Details: spectral properties; chromophores; structual stability

Submission Details

ID: 8jwm55MZ3

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:39 p.m.

Version: 1

Publication Details
Schechter AN;Epstein CJ,J. Mol. Biol. (1968) Spectral studies on the denaturation of myoglobin. PMID:5673697
Additional Information

Study Summary

Number of data points 2
Proteins Myoglobin ; Myoglobin ; Myoglobin ; Myoglobin
Unique complexes 2
Assays/Quantities/Protocols Experimental Assay: dG_H2O
Libraries Mutations for sequence VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; Mutations for sequence GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
100.0 Myoglobin P02185 MYG_PHYMC
96.8 Myoglobin Q0KIY5 MYG_KOGBR
96.8 Myoglobin P02184 MYG_KOGSI
92.9 Myoglobin Q0KIY1 MYG_BALBO
92.9 Myoglobin Q0KIY2 MYG_BALED
92.9 Myoglobin P02177 MYG_ESCRO
92.2 Myoglobin P02178 MYG_MEGNO
91.4 Myoglobin Q0KIY3 MYG_PENEL
91.6 Myoglobin P02181 MYG_INIGE
92.1 Myoglobin P02174 MYG_GLOME
90.9 Myoglobin P02179 MYG_BALAC
91.4 Myoglobin P02173 MYG_ORCOR
90.8 Myoglobin Q0KIY7 MYG1_STEAT
90.8 Myoglobin P68276 MYG_DELDE
90.8 Myoglobin P68279 MYG_TURTR
90.8 Myoglobin P68277 MYG_PHODA
90.8 Myoglobin P68278 MYG_PHOPH
90.3 Myoglobin P02180 MYG_BALPH
90.3 Myoglobin P02183 MYG_MESCA
90.3 Myoglobin Q0KIY0 MYG_MESST
90.1 Myoglobin P02182 MYG_ZIPCA
100.0 Myoglobin P68083 MYG_EQUBU
100.0 Myoglobin P68082 MYG_HORSE
92.2 Myoglobin P02169 MYG_LEPMU
90.9 Myoglobin P02166 MYG_PERPO
90.9 Myoglobin P02189 MYG_PIG
90.3 Myoglobin P02167 MYG_NYCCO
90.3 Myoglobin P02165 MYG_TUPGL
90.9 Myoglobin P11343 MYG_LUTLU
90.3 Myoglobin P02163 MYG_ROUAE