A scanning calorimetric study of the thermal denaturation of the lysozyme of phage T4 and the Arg 96----His mutant form thereof.


Abstract

High-sensitivity scanning calorimetry has been employed to study the reversible thermal unfolding of the lysozyme of T4 bacteriophage and of its mutant form Arg 96----His in the pH range 1.80-2.84. The values for t1/2, the temperature of half-denaturation, in degrees Celsius and for the enthalpy of unfolding in kilocalories per mole are given by (standard deviations in parentheses) wild type t1/2 = 9.63 + 14.41 pH (+/- 0.58) delta Hcal = 5.97 + 2.33t (+/- 4.20) mutant form t1/2 = -19.84 + 21.31 pH (+/- 0.51) delta Hcal = -8.58 + 2.66t (+/- 4.48) At any temperature within the range -20 to 60 degrees C, the free energy of unfolding of the mutant form is more negative than that of the wild type by 3-5 kcal mol-1, indicating an apparent destabilization resulting from the arginine to histidine replacement. The ratio of the van't Hoff enthalpy to the calorimetric enthalpy deviates from unity, the value expected for a simple two-state process, by +/- 0.2 depending on the pH. It thus appears that the nature of the unfolding of T4 lysozyme varies with pH in unknown manner. This complication does not invalidate the values reported here for the temperature of half-completion of unfolding, the calorimetric enthalpy, the heat capacity change, or the free energy of unfolding. Study holds ProTherm entries: 3804, 3805, 3806, 3807, 3808, 3809, 3810, 3811, 3812, 3813, 3814, 3815, 3816, 3817, 3818, 3819, 3820, 10664, 10665, 10666, 10667, 10668, 10669, 10670, 10671, 10672, 10673, 10674, 10675, 10676, 10677, 10678, 10679, 10680, 10681, 10682, 10683, 10684, 10685, 10686, 10687, 10688, 10689, 10690, 10691, 10692, 10693, 10694, 10695, 10696, 10697, 10698, 10699, 10700, 10701, 10702, 10703, 10704, 10705, 10706, 10707, 10708, 10709, 10710, 10711, 10712, 10713, 10714, 10715, 10716, 10717, 10718, 10719, 10720, 10721, 10722 Extra Details: enthalpy of unfolding; apparent destabilization; arginine to,histidine replacement; heat capacity change; free energy

Submission Details

ID: 6NG7if954

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:22 p.m.

Version: 1

Publication Details
Kitamura S;Sturtevant JM,Biochemistry (1989) A scanning calorimetric study of the thermal denaturation of the lysozyme of phage T4 and the Arg 96----His mutant form thereof. PMID:2665807
Additional Information

Study Summary

Number of data points 311
Proteins Endolysin ; Endolysin ; Endolysin
Unique complexes 2
Assays/Quantities/Protocols Experimental Assay: dCp pH:2.84, prot_conc:1.54 mg/mL ; Experimental Assay: dHcal pH:2.84, prot_conc:1.54 mg/mL ; Experimental Assay: Tm pH:2.84, prot_conc:1.54 mg/mL ; Experimental Assay: dHvH pH:2.84, prot_conc:1.54 mg/mL ; Experimental Assay: dCp prot_conc:7.05 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:7.05 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:7.05 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:7.05 mg/mL, pH:2.7 ; Experimental Assay: dCp prot_conc:5.64 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:5.64 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:5.64 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:5.64 mg/mL, pH:2.7 ; Experimental Assay: dCp prot_conc:4.23 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:4.23 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:4.23 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:4.23 mg/mL, pH:2.7 ; Experimental Assay: dCp pH:2.7, prot_conc:2.82 mg/mL ; Experimental Assay: dHcal pH:2.7, prot_conc:2.82 mg/mL ; Experimental Assay: Tm pH:2.7, prot_conc:2.82 mg/mL ; Experimental Assay: dHvH pH:2.7, prot_conc:2.82 mg/mL ; Experimental Assay: dCp prot_conc:1.41 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:1.41 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:1.41 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:1.41 mg/mL, pH:2.7 ; Experimental Assay: dCp prot_conc:0.88 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:0.88 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:0.88 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:0.88 mg/mL, pH:2.7 ; Experimental Assay: dCp prot_conc:8.07 mg/mL, pH:2.5 ; Experimental Assay: dHcal prot_conc:8.07 mg/mL, pH:2.5 ; Experimental Assay: Tm prot_conc:8.07 mg/mL, pH:2.5 ; Experimental Assay: dHvH prot_conc:8.07 mg/mL, pH:2.5 ; Experimental Assay: dCp pH:2.5, prot_conc:7.15 mg/mL ; Experimental Assay: dHcal pH:2.5, prot_conc:7.15 mg/mL ; Experimental Assay: Tm pH:2.5, prot_conc:7.15 mg/mL ; Experimental Assay: dHvH pH:2.5, prot_conc:7.15 mg/mL ; Experimental Assay: dCp prot_conc:4.84 mg/mL, pH:2.5 ; Experimental Assay: dHcal prot_conc:4.84 mg/mL, pH:2.5 ; Experimental Assay: Tm prot_conc:4.84 mg/mL, pH:2.5 ; Experimental Assay: dHvH prot_conc:4.84 mg/mL, pH:2.5 ; Experimental Assay: dCp pH:2.5, prot_conc:3.22 mg/mL ; Experimental Assay: dHcal pH:2.5, prot_conc:3.22 mg/mL ; Experimental Assay: Tm pH:2.5, prot_conc:3.22 mg/mL ; Experimental Assay: dHvH pH:2.5, prot_conc:3.22 mg/mL ; Experimental Assay: dCp pH:2.5, prot_conc:1.61 mg/mL ; Experimental Assay: dHcal pH:2.5, prot_conc:1.61 mg/mL ; Experimental Assay: Tm pH:2.5, prot_conc:1.61 mg/mL ; Experimental Assay: dHvH pH:2.5, prot_conc:1.61 mg/mL ; Experimental Assay: dCp pH:2.4, prot_conc:4.86 mg/mL ; Experimental Assay: dHcal pH:2.4, prot_conc:4.86 mg/mL ; Experimental Assay: Tm pH:2.4, prot_conc:4.86 mg/mL ; Experimental Assay: dHvH pH:2.4, prot_conc:4.86 mg/mL ; Experimental Assay: dCp pH:2.4, prot_conc:2.43 mg/mL ; Experimental Assay: dHcal pH:2.4, prot_conc:2.43 mg/mL ; Experimental Assay: Tm pH:2.4, prot_conc:2.43 mg/mL ; Experimental Assay: dHvH pH:2.4, prot_conc:2.43 mg/mL ; Experimental Assay: dCp pH:2.4, prot_conc:1.22 mg/mL ; Experimental Assay: dHcal pH:2.4, prot_conc:1.22 mg/mL ; Experimental Assay: Tm pH:2.4, prot_conc:1.22 mg/mL ; Experimental Assay: dHvH pH:2.4, prot_conc:1.22 mg/mL ; Experimental Assay: dCp pH:2.34, prot_conc:4.35 mg/mL ; Experimental Assay: dHcal pH:2.34, prot_conc:4.35 mg/mL ; Experimental Assay: Tm pH:2.34, prot_conc:4.35 mg/mL ; Experimental Assay: dHvH pH:2.34, prot_conc:4.35 mg/mL ; Experimental Assay: dCp prot_conc:7.29 mg/mL, pH:2.2 ; Experimental Assay: dHcal prot_conc:7.29 mg/mL, pH:2.2 ; Experimental Assay: Tm prot_conc:7.29 mg/mL, pH:2.2 ; Experimental Assay: dHvH prot_conc:7.29 mg/mL, pH:2.2 ; Experimental Assay: dCp prot_conc:8.77 mg/mL, pH:2.0 ; Experimental Assay: dHcal prot_conc:8.77 mg/mL, pH:2.0 ; Experimental Assay: Tm prot_conc:8.77 mg/mL, pH:2.0 ; Experimental Assay: dHvH prot_conc:8.77 mg/mL, pH:2.0 ; Experimental Assay: dCp pH:2.0, prot_conc:7.97 mg/mL ; Experimental Assay: dHcal pH:2.0, prot_conc:7.97 mg/mL ; Experimental Assay: Tm pH:2.0, prot_conc:7.97 mg/mL ; Experimental Assay: dHvH prot_conc:7.97 mg/mL, pH:2.0 ; Experimental Assay: dCp pH:2.0, prot_conc:4.38 mg/mL ; Experimental Assay: dHcal pH:2.0, prot_conc:4.38 mg/mL ; Experimental Assay: Tm pH:2.0, prot_conc:4.38 mg/mL ; Experimental Assay: dHvH prot_conc:4.38 mg/mL, pH:2.0 ; Experimental Assay: dCp prot_conc:4.13 mg/mL, pH:2.0 ; Experimental Assay: dHcal prot_conc:4.13 mg/mL, pH:2.0 ; Experimental Assay: Tm prot_conc:4.13 mg/mL, pH:2.0 ; Experimental Assay: dHvH prot_conc:4.13 mg/mL, pH:2.0 ; Experimental Assay: dCp pH:2.0, prot_conc:3.11 mg/mL ; Experimental Assay: dHcal pH:2.0, prot_conc:3.11 mg/mL ; Experimental Assay: Tm pH:2.0, prot_conc:3.11 mg/mL ; Experimental Assay: dHvH pH:2.0, prot_conc:3.11 mg/mL ; Experimental Assay: dCp pH:2.0, prot_conc:2.19 mg/mL ; Experimental Assay: dHcal pH:2.0, prot_conc:2.19 mg/mL ; Experimental Assay: Tm pH:2.0, prot_conc:2.19 mg/mL ; Experimental Assay: dHvH pH:2.0, prot_conc:2.19 mg/mL ; Experimental Assay: dCp pH:2.0, prot_conc:0.89 mg/mL ; Experimental Assay: dHcal pH:2.0, prot_conc:0.89 mg/mL ; Experimental Assay: Tm pH:2.0, prot_conc:0.89 mg/mL ; Experimental Assay: dHvH prot_conc:0.89 mg/mL, pH:2.0 ; Experimental Assay: dCp prot_conc:7.46 mg/mL, pH:1.8 ; Experimental Assay: dHcal prot_conc:7.46 mg/mL, pH:1.8 ; Experimental Assay: Tm prot_conc:7.46 mg/mL, pH:1.8 ; Experimental Assay: dHvH prot_conc:7.46 mg/mL, pH:1.8 ; Experimental Assay: dCp prot_conc:7.43 mg/mL, pH:1.8 ; Experimental Assay: dHcal prot_conc:7.43 mg/mL, pH:1.8 ; Experimental Assay: Tm prot_conc:7.43 mg/mL, pH:1.8 ; Experimental Assay: dHvH prot_conc:7.43 mg/mL, pH:1.8 ; Experimental Assay: dCp prot_conc:3.69 mg/mL, pH:1.8 ; Experimental Assay: dHcal prot_conc:3.69 mg/mL, pH:1.8 ; Experimental Assay: Tm prot_conc:3.69 mg/mL, pH:1.8 ; Experimental Assay: dHvH prot_conc:3.69 mg/mL, pH:1.8 ; Experimental Assay: dCp prot_conc:1.86 mg/mL, pH:1.8 ; Experimental Assay: dHcal prot_conc:1.86 mg/mL, pH:1.8 ; Experimental Assay: Tm prot_conc:1.86 mg/mL, pH:1.8 ; Experimental Assay: dHvH prot_conc:1.86 mg/mL, pH:1.8 ; Experimental Assay: dCp prot_conc:0.82 mg/mL, pH:1.8 ; Experimental Assay: dHcal prot_conc:0.82 mg/mL, pH:1.8 ; Experimental Assay: Tm prot_conc:0.82 mg/mL, pH:1.8 ; Experimental Assay: dHvH prot_conc:0.82 mg/mL, pH:1.8 ; Experimental Assay: dCp prot_conc:1.77 mg/mL, pH:1.6 ; Experimental Assay: dHcal prot_conc:1.77 mg/mL, pH:1.6 ; Experimental Assay: Tm prot_conc:1.77 mg/mL, pH:1.6 ; Experimental Assay: dHvH prot_conc:1.77 mg/mL, pH:1.6 ; Experimental Assay: dTm pH:2.84 ; Experimental Assay: dTm pH:2.7 ; Experimental Assay: dTm pH:2.5 ; Experimental Assay: dTm pH:2.4 ; Experimental Assay: dTm pH:2.34 ; Experimental Assay: dCp pH:2.84, prot_conc:6.71 mg/mL ; Experimental Assay: dHcal pH:2.84, prot_conc:6.71 mg/mL ; Experimental Assay: Tm pH:2.84, prot_conc:6.71 mg/mL ; Experimental Assay: dHvH pH:2.84, prot_conc:6.71 mg/mL ; Experimental Assay: dCp pH:2.84, prot_conc:4.03 mg/mL ; Experimental Assay: dHcal pH:2.84, prot_conc:4.03 mg/mL ; Experimental Assay: Tm pH:2.84, prot_conc:4.03 mg/mL ; Experimental Assay: dHvH pH:2.84, prot_conc:4.03 mg/mL ; Experimental Assay: dCp pH:2.84, prot_conc:1.34 mg/mL ; Experimental Assay: dHcal pH:2.84, prot_conc:1.34 mg/mL ; Experimental Assay: Tm pH:2.84, prot_conc:1.34 mg/mL ; Experimental Assay: dHvH pH:2.84, prot_conc:1.34 mg/mL ; Experimental Assay: dCp pH:2.7, prot_conc:6.45 mg/mL ; Experimental Assay: dHcal pH:2.7, prot_conc:6.45 mg/mL ; Experimental Assay: Tm pH:2.7, prot_conc:6.45 mg/mL ; Experimental Assay: dHvH pH:2.7, prot_conc:6.45 mg/mL ; Experimental Assay: dCp prot_conc:5.16 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:5.16 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:5.16 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:5.16 mg/mL, pH:2.7 ; Experimental Assay: dCp prot_conc:3.87 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:3.87 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:3.87 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:3.87 mg/mL, pH:2.7 ; Experimental Assay: dCp prot_conc:2.58 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:2.58 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:2.58 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:2.58 mg/mL, pH:2.7 ; Experimental Assay: dCp prot_conc:1.29 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:1.29 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:1.29 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:1.29 mg/mL, pH:2.7 ; Experimental Assay: dCp pH:2.5, prot_conc:8.66 mg/mL ; Experimental Assay: dHcal pH:2.5, prot_conc:8.66 mg/mL ; Experimental Assay: Tm pH:2.5, prot_conc:8.66 mg/mL ; Experimental Assay: dHvH pH:2.5, prot_conc:8.66 mg/mL ; Experimental Assay: dCp pH:2.5, prot_conc:3.20 mg/mL ; Experimental Assay: dHcal pH:2.5, prot_conc:3.20 mg/mL ; Experimental Assay: Tm pH:2.5, prot_conc:3.20 mg/mL ; Experimental Assay: dHvH pH:2.5, prot_conc:3.20 mg/mL ; Experimental Assay: dCp pH:2.5, prot_conc:1.29 mg/mL ; Experimental Assay: dHcal pH:2.5, prot_conc:1.29 mg/mL ; Experimental Assay: Tm pH:2.5, prot_conc:1.29 mg/mL ; Experimental Assay: dHvH pH:2.5, prot_conc:1.29 mg/mL ; Experimental Assay: dCp pH:2.4, prot_conc:5.26 mg/mL ; Experimental Assay: dHcal pH:2.4, prot_conc:5.26 mg/mL ; Experimental Assay: Tm pH:2.4, prot_conc:5.26 mg/mL ; Experimental Assay: dHvH pH:2.4, prot_conc:5.26 mg/mL ; Experimental Assay: dCp pH:2.4, prot_conc:3.51 mg/mL ; Experimental Assay: dHcal pH:2.4, prot_conc:3.51 mg/mL ; Experimental Assay: Tm pH:2.4, prot_conc:3.51 mg/mL ; Experimental Assay: dHvH pH:2.4, prot_conc:3.51 mg/mL ; Experimental Assay: dCp pH:2.4, prot_conc:1.75 mg/mL ; Experimental Assay: dHcal pH:2.4, prot_conc:1.75 mg/mL ; Experimental Assay: Tm pH:2.4, prot_conc:1.75 mg/mL ; Experimental Assay: dHvH pH:2.4, prot_conc:1.75 mg/mL ; Experimental Assay: dCp prot_conc:8.29 mg/mL, pH:2.34 ; Experimental Assay: dHcal prot_conc:8.29 mg/mL, pH:2.34 ; Experimental Assay: Tm prot_conc:8.29 mg/mL, pH:2.34 ; Experimental Assay: dHvH prot_conc:8.29 mg/mL, pH:2.34 ; Experimental Assay: dCp prot_conc:4.14 mg/mL, pH:2.34 ; Experimental Assay: dHcal prot_conc:4.14 mg/mL, pH:2.34 ; Experimental Assay: Tm prot_conc:4.14 mg/mL, pH:2.34 ; Experimental Assay: dHvH prot_conc:4.14 mg/mL, pH:2.34 ; Experimental Assay: dCp prot_conc:7.84 mg/mL, pH:2.2 ; Experimental Assay: dHcal prot_conc:7.84 mg/mL, pH:2.2 ; Experimental Assay: Tm prot_conc:7.84 mg/mL, pH:2.2 ; Experimental Assay: dHvH prot_conc:7.84 mg/mL, pH:2.2 ; Experimental Assay: dCp prot_conc:3.14 mg/mL, pH:2.2 ; Experimental Assay: dHcal prot_conc:3.14 mg/mL, pH:2.2 ; Experimental Assay: Tm prot_conc:3.14 mg/mL, pH:2.2 ; Experimental Assay: dHvH prot_conc:3.14 mg/mL, pH:2.2 ; Experimental Assay: dCp prot_conc:1.14 mg/mL, pH:2.2 ; Experimental Assay: dHcal prot_conc:1.14 mg/mL, pH:2.2 ; Experimental Assay: Tm prot_conc:1.14 mg/mL, pH:2.2 ; Experimental Assay: dHvH prot_conc:1.14 mg/mL, pH:2.2 ; Experimental Assay: dCp prot_conc:8.01 mg/mL, pH:2.1 ; Experimental Assay: dHcal prot_conc:8.01 mg/mL, pH:2.1 ; Experimental Assay: Tm prot_conc:8.01 mg/mL, pH:2.1 ; Experimental Assay: dHvH prot_conc:8.01 mg/mL, pH:2.1 ; Experimental Assay: dCp prot_conc:4.00 mg/mL, pH:2.1 ; Experimental Assay: dHcal prot_conc:4.00 mg/mL, pH:2.1 ; Experimental Assay: Tm prot_conc:4.00 mg/mL, pH:2.1 ; Experimental Assay: dHvH prot_conc:4.00 mg/mL, pH:2.1 ; Experimental Assay: dCp prot_conc:8.56 mg/mL, pH:2.0 ; Experimental Assay: dHcal prot_conc:8.56 mg/mL, pH:2.0 ; Experimental Assay: Tm prot_conc:8.56 mg/mL, pH:2.0 ; Experimental Assay: dHvH prot_conc:8.56 mg/mL, pH:2.0 ; Experimental Assay: dCp prot_conc:7.74 mg/mL, pH:2.0 ; Experimental Assay: dHcal prot_conc:7.74 mg/mL, pH:2.0 ; Experimental Assay: Tm prot_conc:7.74 mg/mL, pH:2.0 ; Experimental Assay: dHvH prot_conc:7.74 mg/mL, pH:2.0 ; Experimental Assay: dCp pH:2.0, prot_conc:5.14 mg/mL ; Experimental Assay: dHcal pH:2.0, prot_conc:5.14 mg/mL ; Experimental Assay: Tm pH:2.0, prot_conc:5.14 mg/mL ; Experimental Assay: dHvH pH:2.0, prot_conc:5.14 mg/mL ; Experimental Assay: dCp prot_conc:4.16 mg/mL, pH:2.0 ; Experimental Assay: dHcal prot_conc:4.16 mg/mL, pH:2.0 ; Experimental Assay: Tm prot_conc:4.16 mg/mL, pH:2.0 ; Experimental Assay: dHvH prot_conc:4.16 mg/mL, pH:2.0 ; Experimental Assay: dCp prot_conc:3.43 mg/mL, pH:2.0 ; Experimental Assay: dHcal prot_conc:3.43 mg/mL, pH:2.0 ; Experimental Assay: Tm prot_conc:3.43 mg/mL, pH:2.0 ; Experimental Assay: dHvH prot_conc:3.43 mg/mL, pH:2.0 ; Experimental Assay: dCp prot_conc:1.71 mg/mL, pH:2.0 ; Experimental Assay: dHcal prot_conc:1.71 mg/mL, pH:2.0 ; Experimental Assay: Tm prot_conc:1.71 mg/mL, pH:2.0 ; Experimental Assay: dHvH prot_conc:1.71 mg/mL, pH:2.0 ; Experimental Assay: dCp pH:2.84, prot_conc:3.90 mg/mL ; Experimental Assay: dHcal pH:2.84, prot_conc:3.90 mg/mL ; Experimental Assay: Tm pH:2.84, prot_conc:3.90 mg/mL ; Experimental Assay: dHvH pH:2.84, prot_conc:3.90 mg/mL ; Experimental Assay: dTm pH:2.2 ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:2.1 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:2.1 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:2.1 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:2.1 ; Experimental Assay: dTm pH:2.0 ; Experimental Assay: dCp pH:2.84, prot_conc:8.29 mg/ml ; Experimental Assay: dHcal pH:2.84, prot_conc:8.29 mg/ml ; Experimental Assay: Tm pH:2.84, prot_conc:8.29 mg/ml ; Experimental Assay: dHvH pH:2.84, prot_conc:8.29 mg/ml ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:2.7 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:2.7 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:2.7 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:2.7 ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:2.5 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:2.5 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:2.5 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:2.5 ; Experimental Assay: dCp pH:2.4, prot_conc:8.29 mg/ml ; Experimental Assay: dHcal pH:2.4, prot_conc:8.29 mg/ml ; Experimental Assay: Tm pH:2.4, prot_conc:8.29 mg/ml ; Experimental Assay: dHvH pH:2.4, prot_conc:8.29 mg/ml ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:2.34 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:2.34 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:2.34 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:2.34 ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:2.2 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:2.2 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:2.2 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:2.2 ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:2.0 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:2.0 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:2.0 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:2.0 ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:1.8 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:1.8 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:1.8 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:1.8 ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:1.6 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:1.6 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:1.6 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:1.6
Libraries Mutations for sequence MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Structure view and single mutant data analysis

Study data

No weblogo for data of varying length.
Colors: D E R H K S T N Q A V I L M F Y W C G P
 

Data Distribution

Studies with similar sequences (approximate matches)

Correlation with other assays (exact sequence matches)


Relevant PDB Entries

Structure ID Release Date Resolution Structure Title
102L 1992-09-29T00:00:00+0000 1.74 HOW AMINO-ACID INSERTIONS ARE ALLOWED IN AN ALPHA-HELIX OF T4 LYSOZYME
103L 1992-09-29T00:00:00+0000 1.9 HOW AMINO-ACID INSERTIONS ARE ALLOWED IN AN ALPHA-HELIX OF T4 LYSOZYME
104L 1992-09-29T00:00:00+0000 2.8 HOW AMINO-ACID INSERTIONS ARE ALLOWED IN AN ALPHA-HELIX OF T4 LYSOZYME
107L 1992-12-17T00:00:00+0000 1.8 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
108L 1992-12-17T00:00:00+0000 1.8 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
109L 1992-12-17T00:00:00+0000 1.85 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
110L 1992-12-17T00:00:00+0000 1.7 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
111L 1992-12-17T00:00:00+0000 1.8 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
112L 1992-12-17T00:00:00+0000 1.8 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME
113L 1992-12-17T00:00:00+0000 1.8 STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME

Relevant UniProtKB Entries

Percent Identity Matching Chains Protein Accession Entry Name
100.0 Endolysin P00720 ENLYS_BPT4