A scanning calorimetric study of the thermal denaturation of the lysozyme of phage T4 and the Arg 96----His mutant form thereof.


Abstract

High-sensitivity scanning calorimetry has been employed to study the reversible thermal unfolding of the lysozyme of T4 bacteriophage and of its mutant form Arg 96----His in the pH range 1.80-2.84. The values for t1/2, the temperature of half-denaturation, in degrees Celsius and for the enthalpy of unfolding in kilocalories per mole are given by (standard deviations in parentheses) wild type t1/2 = 9.63 + 14.41 pH (+/- 0.58) delta Hcal = 5.97 + 2.33t (+/- 4.20) mutant form t1/2 = -19.84 + 21.31 pH (+/- 0.51) delta Hcal = -8.58 + 2.66t (+/- 4.48) At any temperature within the range -20 to 60 degrees C, the free energy of unfolding of the mutant form is more negative than that of the wild type by 3-5 kcal mol-1, indicating an apparent destabilization resulting from the arginine to histidine replacement. The ratio of the van't Hoff enthalpy to the calorimetric enthalpy deviates from unity, the value expected for a simple two-state process, by +/- 0.2 depending on the pH. It thus appears that the nature of the unfolding of T4 lysozyme varies with pH in unknown manner. This complication does not invalidate the values reported here for the temperature of half-completion of unfolding, the calorimetric enthalpy, the heat capacity change, or the free energy of unfolding. Study holds ProTherm entries: 3804, 3805, 3806, 3807, 3808, 3809, 3810, 3811, 3812, 3813, 3814, 3815, 3816, 3817, 3818, 3819, 3820, 10664, 10665, 10666, 10667, 10668, 10669, 10670, 10671, 10672, 10673, 10674, 10675, 10676, 10677, 10678, 10679, 10680, 10681, 10682, 10683, 10684, 10685, 10686, 10687, 10688, 10689, 10690, 10691, 10692, 10693, 10694, 10695, 10696, 10697, 10698, 10699, 10700, 10701, 10702, 10703, 10704, 10705, 10706, 10707, 10708, 10709, 10710, 10711, 10712, 10713, 10714, 10715, 10716, 10717, 10718, 10719, 10720, 10721, 10722 Extra Details: enthalpy of unfolding; apparent destabilization; arginine to,histidine replacement; heat capacity change; free energy

Submission Details

ID: 6NG7if954

Submitter: Connie Wang

Submission Date: April 24, 2018, 8:22 p.m.

Version: 1

Publication Details
Kitamura S;Sturtevant JM,Biochemistry (1989) A scanning calorimetric study of the thermal denaturation of the lysozyme of phage T4 and the Arg 96----His mutant form thereof. PMID:2665807
Additional Information

Number of data points 311
Proteins Endolysin ; Endolysin ; Endolysin
Unique complexes 2
Assays/Quantities/Protocols Experimental Assay: dCp pH:2.84, prot_conc:1.54 mg/mL ; Experimental Assay: dHcal pH:2.84, prot_conc:1.54 mg/mL ; Experimental Assay: Tm pH:2.84, prot_conc:1.54 mg/mL ; Experimental Assay: dHvH pH:2.84, prot_conc:1.54 mg/mL ; Experimental Assay: dCp prot_conc:7.05 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:7.05 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:7.05 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:7.05 mg/mL, pH:2.7 ; Experimental Assay: dCp prot_conc:5.64 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:5.64 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:5.64 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:5.64 mg/mL, pH:2.7 ; Experimental Assay: dCp prot_conc:4.23 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:4.23 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:4.23 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:4.23 mg/mL, pH:2.7 ; Experimental Assay: dCp pH:2.7, prot_conc:2.82 mg/mL ; Experimental Assay: dHcal pH:2.7, prot_conc:2.82 mg/mL ; Experimental Assay: Tm pH:2.7, prot_conc:2.82 mg/mL ; Experimental Assay: dHvH pH:2.7, prot_conc:2.82 mg/mL ; Experimental Assay: dCp prot_conc:1.41 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:1.41 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:1.41 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:1.41 mg/mL, pH:2.7 ; Experimental Assay: dCp prot_conc:0.88 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:0.88 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:0.88 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:0.88 mg/mL, pH:2.7 ; Experimental Assay: dCp prot_conc:8.07 mg/mL, pH:2.5 ; Experimental Assay: dHcal prot_conc:8.07 mg/mL, pH:2.5 ; Experimental Assay: Tm prot_conc:8.07 mg/mL, pH:2.5 ; Experimental Assay: dHvH prot_conc:8.07 mg/mL, pH:2.5 ; Experimental Assay: dCp pH:2.5, prot_conc:7.15 mg/mL ; Experimental Assay: dHcal pH:2.5, prot_conc:7.15 mg/mL ; Experimental Assay: Tm pH:2.5, prot_conc:7.15 mg/mL ; Experimental Assay: dHvH pH:2.5, prot_conc:7.15 mg/mL ; Experimental Assay: dCp prot_conc:4.84 mg/mL, pH:2.5 ; Experimental Assay: dHcal prot_conc:4.84 mg/mL, pH:2.5 ; Experimental Assay: Tm prot_conc:4.84 mg/mL, pH:2.5 ; Experimental Assay: dHvH prot_conc:4.84 mg/mL, pH:2.5 ; Experimental Assay: dCp pH:2.5, prot_conc:3.22 mg/mL ; Experimental Assay: dHcal pH:2.5, prot_conc:3.22 mg/mL ; Experimental Assay: Tm pH:2.5, prot_conc:3.22 mg/mL ; Experimental Assay: dHvH pH:2.5, prot_conc:3.22 mg/mL ; Experimental Assay: dCp pH:2.5, prot_conc:1.61 mg/mL ; Experimental Assay: dHcal pH:2.5, prot_conc:1.61 mg/mL ; Experimental Assay: Tm pH:2.5, prot_conc:1.61 mg/mL ; Experimental Assay: dHvH pH:2.5, prot_conc:1.61 mg/mL ; Experimental Assay: dCp pH:2.4, prot_conc:4.86 mg/mL ; Experimental Assay: dHcal pH:2.4, prot_conc:4.86 mg/mL ; Experimental Assay: Tm pH:2.4, prot_conc:4.86 mg/mL ; Experimental Assay: dHvH pH:2.4, prot_conc:4.86 mg/mL ; Experimental Assay: dCp pH:2.4, prot_conc:2.43 mg/mL ; Experimental Assay: dHcal pH:2.4, prot_conc:2.43 mg/mL ; Experimental Assay: Tm pH:2.4, prot_conc:2.43 mg/mL ; Experimental Assay: dHvH pH:2.4, prot_conc:2.43 mg/mL ; Experimental Assay: dCp pH:2.4, prot_conc:1.22 mg/mL ; Experimental Assay: dHcal pH:2.4, prot_conc:1.22 mg/mL ; Experimental Assay: Tm pH:2.4, prot_conc:1.22 mg/mL ; Experimental Assay: dHvH pH:2.4, prot_conc:1.22 mg/mL ; Experimental Assay: dCp pH:2.34, prot_conc:4.35 mg/mL ; Experimental Assay: dHcal pH:2.34, prot_conc:4.35 mg/mL ; Experimental Assay: Tm pH:2.34, prot_conc:4.35 mg/mL ; Experimental Assay: dHvH pH:2.34, prot_conc:4.35 mg/mL ; Experimental Assay: dCp prot_conc:7.29 mg/mL, pH:2.2 ; Experimental Assay: dHcal prot_conc:7.29 mg/mL, pH:2.2 ; Experimental Assay: Tm prot_conc:7.29 mg/mL, pH:2.2 ; Experimental Assay: dHvH prot_conc:7.29 mg/mL, pH:2.2 ; Experimental Assay: dCp prot_conc:8.77 mg/mL, pH:2.0 ; Experimental Assay: dHcal prot_conc:8.77 mg/mL, pH:2.0 ; Experimental Assay: Tm prot_conc:8.77 mg/mL, pH:2.0 ; Experimental Assay: dHvH prot_conc:8.77 mg/mL, pH:2.0 ; Experimental Assay: dCp pH:2.0, prot_conc:7.97 mg/mL ; Experimental Assay: dHcal pH:2.0, prot_conc:7.97 mg/mL ; Experimental Assay: Tm pH:2.0, prot_conc:7.97 mg/mL ; Experimental Assay: dHvH prot_conc:7.97 mg/mL, pH:2.0 ; Experimental Assay: dCp pH:2.0, prot_conc:4.38 mg/mL ; Experimental Assay: dHcal pH:2.0, prot_conc:4.38 mg/mL ; Experimental Assay: Tm pH:2.0, prot_conc:4.38 mg/mL ; Experimental Assay: dHvH prot_conc:4.38 mg/mL, pH:2.0 ; Experimental Assay: dCp prot_conc:4.13 mg/mL, pH:2.0 ; Experimental Assay: dHcal prot_conc:4.13 mg/mL, pH:2.0 ; Experimental Assay: Tm prot_conc:4.13 mg/mL, pH:2.0 ; Experimental Assay: dHvH prot_conc:4.13 mg/mL, pH:2.0 ; Experimental Assay: dCp pH:2.0, prot_conc:3.11 mg/mL ; Experimental Assay: dHcal pH:2.0, prot_conc:3.11 mg/mL ; Experimental Assay: Tm pH:2.0, prot_conc:3.11 mg/mL ; Experimental Assay: dHvH pH:2.0, prot_conc:3.11 mg/mL ; Experimental Assay: dCp pH:2.0, prot_conc:2.19 mg/mL ; Experimental Assay: dHcal pH:2.0, prot_conc:2.19 mg/mL ; Experimental Assay: Tm pH:2.0, prot_conc:2.19 mg/mL ; Experimental Assay: dHvH pH:2.0, prot_conc:2.19 mg/mL ; Experimental Assay: dCp pH:2.0, prot_conc:0.89 mg/mL ; Experimental Assay: dHcal pH:2.0, prot_conc:0.89 mg/mL ; Experimental Assay: Tm pH:2.0, prot_conc:0.89 mg/mL ; Experimental Assay: dHvH prot_conc:0.89 mg/mL, pH:2.0 ; Experimental Assay: dCp prot_conc:7.46 mg/mL, pH:1.8 ; Experimental Assay: dHcal prot_conc:7.46 mg/mL, pH:1.8 ; Experimental Assay: Tm prot_conc:7.46 mg/mL, pH:1.8 ; Experimental Assay: dHvH prot_conc:7.46 mg/mL, pH:1.8 ; Experimental Assay: dCp prot_conc:7.43 mg/mL, pH:1.8 ; Experimental Assay: dHcal prot_conc:7.43 mg/mL, pH:1.8 ; Experimental Assay: Tm prot_conc:7.43 mg/mL, pH:1.8 ; Experimental Assay: dHvH prot_conc:7.43 mg/mL, pH:1.8 ; Experimental Assay: dCp prot_conc:3.69 mg/mL, pH:1.8 ; Experimental Assay: dHcal prot_conc:3.69 mg/mL, pH:1.8 ; Experimental Assay: Tm prot_conc:3.69 mg/mL, pH:1.8 ; Experimental Assay: dHvH prot_conc:3.69 mg/mL, pH:1.8 ; Experimental Assay: dCp prot_conc:1.86 mg/mL, pH:1.8 ; Experimental Assay: dHcal prot_conc:1.86 mg/mL, pH:1.8 ; Experimental Assay: Tm prot_conc:1.86 mg/mL, pH:1.8 ; Experimental Assay: dHvH prot_conc:1.86 mg/mL, pH:1.8 ; Experimental Assay: dCp prot_conc:0.82 mg/mL, pH:1.8 ; Experimental Assay: dHcal prot_conc:0.82 mg/mL, pH:1.8 ; Experimental Assay: Tm prot_conc:0.82 mg/mL, pH:1.8 ; Experimental Assay: dHvH prot_conc:0.82 mg/mL, pH:1.8 ; Experimental Assay: dCp prot_conc:1.77 mg/mL, pH:1.6 ; Experimental Assay: dHcal prot_conc:1.77 mg/mL, pH:1.6 ; Experimental Assay: Tm prot_conc:1.77 mg/mL, pH:1.6 ; Experimental Assay: dHvH prot_conc:1.77 mg/mL, pH:1.6 ; Experimental Assay: dTm pH:2.84 ; Experimental Assay: dTm pH:2.7 ; Experimental Assay: dTm pH:2.5 ; Experimental Assay: dTm pH:2.4 ; Experimental Assay: dTm pH:2.34 ; Experimental Assay: dCp pH:2.84, prot_conc:6.71 mg/mL ; Experimental Assay: dHcal pH:2.84, prot_conc:6.71 mg/mL ; Experimental Assay: Tm pH:2.84, prot_conc:6.71 mg/mL ; Experimental Assay: dHvH pH:2.84, prot_conc:6.71 mg/mL ; Experimental Assay: dCp pH:2.84, prot_conc:4.03 mg/mL ; Experimental Assay: dHcal pH:2.84, prot_conc:4.03 mg/mL ; Experimental Assay: Tm pH:2.84, prot_conc:4.03 mg/mL ; Experimental Assay: dHvH pH:2.84, prot_conc:4.03 mg/mL ; Experimental Assay: dCp pH:2.84, prot_conc:1.34 mg/mL ; Experimental Assay: dHcal pH:2.84, prot_conc:1.34 mg/mL ; Experimental Assay: Tm pH:2.84, prot_conc:1.34 mg/mL ; Experimental Assay: dHvH pH:2.84, prot_conc:1.34 mg/mL ; Experimental Assay: dCp pH:2.7, prot_conc:6.45 mg/mL ; Experimental Assay: dHcal pH:2.7, prot_conc:6.45 mg/mL ; Experimental Assay: Tm pH:2.7, prot_conc:6.45 mg/mL ; Experimental Assay: dHvH pH:2.7, prot_conc:6.45 mg/mL ; Experimental Assay: dCp prot_conc:5.16 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:5.16 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:5.16 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:5.16 mg/mL, pH:2.7 ; Experimental Assay: dCp prot_conc:3.87 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:3.87 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:3.87 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:3.87 mg/mL, pH:2.7 ; Experimental Assay: dCp prot_conc:2.58 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:2.58 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:2.58 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:2.58 mg/mL, pH:2.7 ; Experimental Assay: dCp prot_conc:1.29 mg/mL, pH:2.7 ; Experimental Assay: dHcal prot_conc:1.29 mg/mL, pH:2.7 ; Experimental Assay: Tm prot_conc:1.29 mg/mL, pH:2.7 ; Experimental Assay: dHvH prot_conc:1.29 mg/mL, pH:2.7 ; Experimental Assay: dCp pH:2.5, prot_conc:8.66 mg/mL ; Experimental Assay: dHcal pH:2.5, prot_conc:8.66 mg/mL ; Experimental Assay: Tm pH:2.5, prot_conc:8.66 mg/mL ; Experimental Assay: dHvH pH:2.5, prot_conc:8.66 mg/mL ; Experimental Assay: dCp pH:2.5, prot_conc:3.20 mg/mL ; Experimental Assay: dHcal pH:2.5, prot_conc:3.20 mg/mL ; Experimental Assay: Tm pH:2.5, prot_conc:3.20 mg/mL ; Experimental Assay: dHvH pH:2.5, prot_conc:3.20 mg/mL ; Experimental Assay: dCp pH:2.5, prot_conc:1.29 mg/mL ; Experimental Assay: dHcal pH:2.5, prot_conc:1.29 mg/mL ; Experimental Assay: Tm pH:2.5, prot_conc:1.29 mg/mL ; Experimental Assay: dHvH pH:2.5, prot_conc:1.29 mg/mL ; Experimental Assay: dCp pH:2.4, prot_conc:5.26 mg/mL ; Experimental Assay: dHcal pH:2.4, prot_conc:5.26 mg/mL ; Experimental Assay: Tm pH:2.4, prot_conc:5.26 mg/mL ; Experimental Assay: dHvH pH:2.4, prot_conc:5.26 mg/mL ; Experimental Assay: dCp pH:2.4, prot_conc:3.51 mg/mL ; Experimental Assay: dHcal pH:2.4, prot_conc:3.51 mg/mL ; Experimental Assay: Tm pH:2.4, prot_conc:3.51 mg/mL ; Experimental Assay: dHvH pH:2.4, prot_conc:3.51 mg/mL ; Experimental Assay: dCp pH:2.4, prot_conc:1.75 mg/mL ; Experimental Assay: dHcal pH:2.4, prot_conc:1.75 mg/mL ; Experimental Assay: Tm pH:2.4, prot_conc:1.75 mg/mL ; Experimental Assay: dHvH pH:2.4, prot_conc:1.75 mg/mL ; Experimental Assay: dCp prot_conc:8.29 mg/mL, pH:2.34 ; Experimental Assay: dHcal prot_conc:8.29 mg/mL, pH:2.34 ; Experimental Assay: Tm prot_conc:8.29 mg/mL, pH:2.34 ; Experimental Assay: dHvH prot_conc:8.29 mg/mL, pH:2.34 ; Experimental Assay: dCp prot_conc:4.14 mg/mL, pH:2.34 ; Experimental Assay: dHcal prot_conc:4.14 mg/mL, pH:2.34 ; Experimental Assay: Tm prot_conc:4.14 mg/mL, pH:2.34 ; Experimental Assay: dHvH prot_conc:4.14 mg/mL, pH:2.34 ; Experimental Assay: dCp prot_conc:7.84 mg/mL, pH:2.2 ; Experimental Assay: dHcal prot_conc:7.84 mg/mL, pH:2.2 ; Experimental Assay: Tm prot_conc:7.84 mg/mL, pH:2.2 ; Experimental Assay: dHvH prot_conc:7.84 mg/mL, pH:2.2 ; Experimental Assay: dCp prot_conc:3.14 mg/mL, pH:2.2 ; Experimental Assay: dHcal prot_conc:3.14 mg/mL, pH:2.2 ; Experimental Assay: Tm prot_conc:3.14 mg/mL, pH:2.2 ; Experimental Assay: dHvH prot_conc:3.14 mg/mL, pH:2.2 ; Experimental Assay: dCp prot_conc:1.14 mg/mL, pH:2.2 ; Experimental Assay: dHcal prot_conc:1.14 mg/mL, pH:2.2 ; Experimental Assay: Tm prot_conc:1.14 mg/mL, pH:2.2 ; Experimental Assay: dHvH prot_conc:1.14 mg/mL, pH:2.2 ; Experimental Assay: dCp prot_conc:8.01 mg/mL, pH:2.1 ; Experimental Assay: dHcal prot_conc:8.01 mg/mL, pH:2.1 ; Experimental Assay: Tm prot_conc:8.01 mg/mL, pH:2.1 ; Experimental Assay: dHvH prot_conc:8.01 mg/mL, pH:2.1 ; Experimental Assay: dCp prot_conc:4.00 mg/mL, pH:2.1 ; Experimental Assay: dHcal prot_conc:4.00 mg/mL, pH:2.1 ; Experimental Assay: Tm prot_conc:4.00 mg/mL, pH:2.1 ; Experimental Assay: dHvH prot_conc:4.00 mg/mL, pH:2.1 ; Experimental Assay: dCp prot_conc:8.56 mg/mL, pH:2.0 ; Experimental Assay: dHcal prot_conc:8.56 mg/mL, pH:2.0 ; Experimental Assay: Tm prot_conc:8.56 mg/mL, pH:2.0 ; Experimental Assay: dHvH prot_conc:8.56 mg/mL, pH:2.0 ; Experimental Assay: dCp prot_conc:7.74 mg/mL, pH:2.0 ; Experimental Assay: dHcal prot_conc:7.74 mg/mL, pH:2.0 ; Experimental Assay: Tm prot_conc:7.74 mg/mL, pH:2.0 ; Experimental Assay: dHvH prot_conc:7.74 mg/mL, pH:2.0 ; Experimental Assay: dCp pH:2.0, prot_conc:5.14 mg/mL ; Experimental Assay: dHcal pH:2.0, prot_conc:5.14 mg/mL ; Experimental Assay: Tm pH:2.0, prot_conc:5.14 mg/mL ; Experimental Assay: dHvH pH:2.0, prot_conc:5.14 mg/mL ; Experimental Assay: dCp prot_conc:4.16 mg/mL, pH:2.0 ; Experimental Assay: dHcal prot_conc:4.16 mg/mL, pH:2.0 ; Experimental Assay: Tm prot_conc:4.16 mg/mL, pH:2.0 ; Experimental Assay: dHvH prot_conc:4.16 mg/mL, pH:2.0 ; Experimental Assay: dCp prot_conc:3.43 mg/mL, pH:2.0 ; Experimental Assay: dHcal prot_conc:3.43 mg/mL, pH:2.0 ; Experimental Assay: Tm prot_conc:3.43 mg/mL, pH:2.0 ; Experimental Assay: dHvH prot_conc:3.43 mg/mL, pH:2.0 ; Experimental Assay: dCp prot_conc:1.71 mg/mL, pH:2.0 ; Experimental Assay: dHcal prot_conc:1.71 mg/mL, pH:2.0 ; Experimental Assay: Tm prot_conc:1.71 mg/mL, pH:2.0 ; Experimental Assay: dHvH prot_conc:1.71 mg/mL, pH:2.0 ; Experimental Assay: dCp pH:2.84, prot_conc:3.90 mg/mL ; Experimental Assay: dHcal pH:2.84, prot_conc:3.90 mg/mL ; Experimental Assay: Tm pH:2.84, prot_conc:3.90 mg/mL ; Experimental Assay: dHvH pH:2.84, prot_conc:3.90 mg/mL ; Experimental Assay: dTm pH:2.2 ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:2.1 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:2.1 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:2.1 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:2.1 ; Experimental Assay: dTm pH:2.0 ; Experimental Assay: dCp pH:2.84, prot_conc:8.29 mg/ml ; Experimental Assay: dHcal pH:2.84, prot_conc:8.29 mg/ml ; Experimental Assay: Tm pH:2.84, prot_conc:8.29 mg/ml ; Experimental Assay: dHvH pH:2.84, prot_conc:8.29 mg/ml ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:2.7 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:2.7 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:2.7 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:2.7 ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:2.5 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:2.5 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:2.5 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:2.5 ; Experimental Assay: dCp pH:2.4, prot_conc:8.29 mg/ml ; Experimental Assay: dHcal pH:2.4, prot_conc:8.29 mg/ml ; Experimental Assay: Tm pH:2.4, prot_conc:8.29 mg/ml ; Experimental Assay: dHvH pH:2.4, prot_conc:8.29 mg/ml ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:2.34 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:2.34 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:2.34 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:2.34 ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:2.2 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:2.2 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:2.2 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:2.2 ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:2.0 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:2.0 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:2.0 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:2.0 ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:1.8 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:1.8 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:1.8 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:1.8 ; Experimental Assay: dCp prot_conc:8.29 mg/ml, pH:1.6 ; Experimental Assay: dHcal prot_conc:8.29 mg/ml, pH:1.6 ; Experimental Assay: Tm prot_conc:8.29 mg/ml, pH:1.6 ; Experimental Assay: dHvH prot_conc:8.29 mg/ml, pH:1.6
Libraries Mutations for sequence MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL
Sequence Assay Result Units