Amino acid substitutions that increase the thermal stability of the lambda Cro protein.
Abstract
A mutant Cro protein, which bears the Ile-30----Leu substitution, is thermally unstable and degraded more rapidly than wild-type Cro in vivo. Using an antibody screen, we have isolated five different second site suppressor substitutions that reduce the proteolytic hypersensitivity of this mutant Cro protein. Two of the suppressor substitutions increase the thermal stability of Cro by 12 degrees C to 14 degrees C. These amino acid substitutions affect residues 16 and 26, which are substantially exposed to solvent in the crystal structure of wild-type Cro. Study holds ProTherm entries: 827, 828, 829, 830, 13437, 13438, 13439 Extra Details: enhanced stability; lambda Cro, genetic suppression;,intracellular proteolysis, antibody screen
Submission Details
ID: 2HjJmcCi3
Submitter: Connie Wang
Submission Date: April 24, 2018, 8:16 p.m.
Version: 1
Publication Details
Pakula AA;Sauer RT,Proteins (1989) Amino acid substitutions that increase the thermal stability of the lambda Cro protein. PMID:2780540Additional Information
Study Summary
| Number of data points | 11 |
| Proteins | Regulatory protein cro ; Regulatory protein cro |
| Unique complexes | 4 |
| Assays/Quantities/Protocols | Experimental Assay: ddG ; Experimental Assay: Tm ; Derived Quantity: dTm |
| Libraries | Mutations for sequence MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSNKKTTA |
Structure view and single mutant data analysis
Study data
| Colors: | D | E | R | H | K | S | T | N | Q | A | V | I | L | M | F | Y | W | C | G | P |
|---|
Data Distribution
Studies with similar sequences (approximate matches)
Correlation with other assays (exact sequence matches)
Relevant UniProtKB Entries
| Percent Identity | Matching Chains | Protein | Accession | Entry Name |
|---|---|---|---|---|
| 100.0 | Regulatory protein cro | P03040 | RCRO_LAMBD |