Pro.v4-cNGF, a conformational epitope mapping of Pro-cNGF

Canis lupus familiaris

None

F1PDQ3

GAGWHAGPKVSSASGPNNGFSKGAAFCPGHIKVHSVMSMLFYTLITALLIGIRAEPHPESHVPAGHAIPHAHWTKLQHSLDTALRRARSAPAGAIAARVTGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADAQDLDLEAGSTASVNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVGDKTTASDIKGKEVMVLRGVHINNSVLQYFFLTQCPDPTPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAGRRA