Regulatory protein rop

Escherichia coli

1YO7,1ROP,2IJJ,1QX8,1F4M,2IJH,2IJK,1F4N,2GHY,1RPR,1GMG,2IJI,1RPO,1GTO,1NKD,4DO2,1B6Q,3K79

P03051

MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFGDDGENL