Regulatory protein cro

Escherichia phage lambda

4CRO,1COP,2ORC,2A63,6CRO,1D1L,1D1M,3ORC,2OVG,2ECS,5CRO,1ORC

P03040

MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSNKKTTA