Phosphocarrier protein HPr

Escherichia coli (strain K12)

1CM3,1CM2,2LRK,1PFH,3EZE,1J6T,2XDF,3EZB,1GGR,1OPD,3EZA,1VRC,3CCD,1HDN,2JEL,2LRL,1POH,4XWJ

P0AA04

MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE