Regulatory protein rop

Escherichia coli

1ROP

P03051

MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFGDDGENL