Adenylate kinase

Escherichia coli (strain K12)

2ECK,4X8H,1ANK,4X8M,5EJE,1E4V,4X8L,4AKE,1AKE,4X8O,3HPR,3HPQ,1E4Y

P69441

MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG