General control protein GCN4

Saccharomyces cerevisiae

2ZTA

P03069

RMKQLEDKVEELLSKNYHLENEVARLKKLVGER