DNA-binding protein HU

Geobacillus stearothermophilus

1HUE

P0A3H0

MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRERAARKGRNPQTGEEMEIPASKVPAFKPGKALKDAVK