Cold shock protein CspA

Escherichia coli

1MJC

P0A9X9

SGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL