Cytochrome c oxidase subunit 1

Bos taurus

5GPN,3ASN,5XTH,5W97,5X19,2EIL,2EIM,2DYS,2DYR,2EIN,2EIJ,2EIK,5IY5,1OCZ,5LUF,5XDQ,2Y69,5XDX,3WG7,5B1A,5B1B,5WAU,1V55,1OCC,3X2Q,2YBB,1OCO,3ABK,1OCR,5XTI,3ABL,3ABM,3AG1,3AG3,3AG2,3AG4,1V54,2OCC,5B3S,2ZXW,5X1B,5X1F,3ASO

P00396

MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK