Thiol:disulfide interchange protein DsbA

Escherichia coli (strain K12)

2ZUP,2HI7,2B6M,1DSB,1UN2,4TKY,1AC1,2NDO,1A23,1A24,1A2J,1A2L,1A2M,3E9J,1ACV,6BQX,1BQ7,4ZIJ,1TI1,2LEG,6BR4,1U3A,1FVK,1FVJ,2B3S

P0AEG4

MKKIWLALAGLVLAFSASAAQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK