Cold shock protein CspB

Bacillus subtilis (strain 168)

3PF5,3PF4,2ES2,1NMF,1NMG,2I5L,2I5M,2F52,1CSQ,1CSP

P32081

MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA