DNA-binding protein 7d

Sulfolobus acidocaldarius

1SAP

P13123

MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK