T-cell surface antigen CD2

Rattus norvegicus

1A7B,1A64,1A6P,1T6W,1CDC,1HNG

P08921

MRCKFLGSFFLLFSLSSKGADCRDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILEMVSKPMIYWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEMEVVNCPEKGLPLYLIVGVSAGGLLLVFFGALFIFCICKRKKRNRRRKGEELEIKASRMSTVERGPKPHSTQASAPASQNPVASQAPPPPGHHLQTPGHRPLPPSHRNREHQPKKRPPPSGTQVHQQKGPPLPRPRVQPKPPCGSGDVSLPPPN