Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

Geobacillus stearothermophilus

2PDD

P11961

VIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGA