Head completion protein

Escherichia virus Lambda

1HYW

P68660

MTRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKKYIAELEVQTGMTQRRRGPAGFYV