Head completion protein

Escherichia phage lambda

1HYW,2L6Q,2L6R

P68660

MTRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKKYIAELEVQTGMTQRRRGPAGFYV